BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0961 (768 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 25 2.6 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 24 5.9 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 25.0 bits (52), Expect = 2.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -1 Query: 213 FFGFCSYLFYLITTEIYLLAS 151 F C YLF++IT IY L S Sbjct: 232 FTFICLYLFFIITLSIYGLMS 252 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 23.8 bits (49), Expect = 5.9 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = -3 Query: 766 LKLKNTDIAKELSLPPVKLHCSMLAEDAIKAALSDYRINQQT 641 L ++ ++KELSL +L S++ A++ L YR+ ++ Sbjct: 145 LAMQVAQLSKELSLCRKELQESLMKNAALERELETYRMGARS 186 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 670,724 Number of Sequences: 2352 Number of extensions: 13041 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -