BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0959 (380 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 23 0.92 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 3.7 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 21 4.9 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 21 4.9 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 6.5 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 20 8.5 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 23.4 bits (48), Expect = 0.92 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 290 CSCGKGRLRRRGSQALCRIKPA 225 C+C GR+RRR A R KP+ Sbjct: 406 CACCPGRVRRRYQPAF-RCKPS 426 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.4 bits (43), Expect = 3.7 Identities = 8/29 (27%), Positives = 12/29 (41%) Frame = +1 Query: 202 EAESSGDQAGFIRHSACDPRRRSRPFPHE 288 E G G+ CD R++ P P + Sbjct: 154 ELSQPGSLNGYGSSDGCDARKKKGPTPRQ 182 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/41 (21%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 190 GPSTEAE-SSGDQAGFIRHSACDPRRRSRPFPHEHPSQGQR 309 GP++ ++G + + S + P+P HP G + Sbjct: 67 GPNSPGSFTAGCHSNLLSTSPSGQNKAVAPYPPNHPLSGSK 107 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/41 (21%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 190 GPSTEAE-SSGDQAGFIRHSACDPRRRSRPFPHEHPSQGQR 309 GP++ ++G + + S + P+P HP G + Sbjct: 67 GPNSPGSFTAGCHSNLLSTSPSGQNKAVAPYPPNHPLSGSK 107 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 20.6 bits (41), Expect = 6.5 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 323 QVHCGR*PWLGCSCGKG 273 + H G P++ +CGKG Sbjct: 196 RTHTGEKPYVCKACGKG 212 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 20.2 bits (40), Expect = 8.5 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +3 Query: 105 MVQRTFPPHHRGTLKWWSLVPPVVS 179 MV+ H+ G L++W VVS Sbjct: 267 MVEGNESDHNDGRLRYWRTPSVVVS 291 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,251 Number of Sequences: 438 Number of extensions: 3048 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9300375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -