BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0957 (852 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 30 0.031 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 23 3.6 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 23 4.7 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 23 4.7 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 6.2 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 22 6.2 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 29.9 bits (64), Expect = 0.031 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +1 Query: 391 ILSRYDAETDNFFVTKFDL 447 + S+YDA+ NFF+T FDL Sbjct: 371 LFSKYDAKKRNFFITMFDL 389 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 23.0 bits (47), Expect = 3.6 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +1 Query: 511 NRSALNSSKFNNYNY 555 N + N++ +NNYNY Sbjct: 92 NNNNYNNNNYNNYNY 106 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.6 bits (46), Expect = 4.7 Identities = 11/41 (26%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -3 Query: 472 LKYIRSTETDRIWLRKNYQSPHRSDLKYFYD-VFDNSFIKI 353 LKY+ T+ R+W+ + S + +F++ + N +I+I Sbjct: 104 LKYLTLTDASRVWMPDLFFSNEKEG--HFHNIIMPNVYIRI 142 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.6 bits (46), Expect = 4.7 Identities = 11/41 (26%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -3 Query: 472 LKYIRSTETDRIWLRKNYQSPHRSDLKYFYD-VFDNSFIKI 353 LKY+ T+ R+W+ + S + +F++ + N +I+I Sbjct: 104 LKYLTLTDASRVWMPDLFFSNEKEG--HFHNIIMPNVYIRI 142 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.2 bits (45), Expect = 6.2 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 345 LVTNLSVIHEGKSNNTSVSW 286 L+T+ V GK+ N SV+W Sbjct: 503 LITSSEVRQPGKAPNYSVNW 522 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 22.2 bits (45), Expect = 6.2 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 267 QNNIGCTNSLMYY 305 QN +GC NSL+ Y Sbjct: 335 QNAVGCWNSLLPY 347 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,257 Number of Sequences: 438 Number of extensions: 4434 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27431202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -