BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0954 (775 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 23 2.4 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 7.3 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 9.6 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +2 Query: 23 PGAMIKCRLRSV*FKVSLSLPATSSQYRKCS 115 P + +C ++ K+S+S P+T + KC+ Sbjct: 326 PESNSRCSVKREKIKISVSYPSTETLNTKCN 356 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.8 bits (44), Expect = 7.3 Identities = 16/70 (22%), Positives = 28/70 (40%) Frame = +1 Query: 118 EKTGKPLPDVLKQHFILEGRIEENAALRIIQDGATLLRSEKTMIEIDSPVTVCGDVHGQF 297 E K L V+ QH L +E A+ L E + + D+ ++ Sbjct: 352 EAEKKNLSKVIDQHSQLIDTLENVLAI------VDRLMDETNQLTLQETADAFKDLQDKY 405 Query: 298 YDLMKLFEVG 327 Y+ K++E+G Sbjct: 406 YEEYKMYELG 415 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.4 bits (43), Expect = 9.6 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -1 Query: 649 GYHLSC*FQEKDLHERRGTVGS 584 G H+SC F R G VGS Sbjct: 116 GLHVSCSFSAGSTIIREGDVGS 137 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 231,990 Number of Sequences: 438 Number of extensions: 5149 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -