BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0953 (811 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0662 + 16732965-16733037,16733310-16733413,16734468-167348... 29 3.3 02_01_0075 - 522554-522616,522742-522748,523033-523136,523237-52... 29 3.3 12_02_0509 - 19829360-19830400,19831475-19831821,19831920-19832073 29 4.4 01_01_0569 - 4214513-4214669,4215082-4216031,4216488-4216547 29 5.8 10_08_0772 + 20471748-20473004 28 7.6 07_03_1559 + 27727492-27728193 28 7.6 >05_03_0662 + 16732965-16733037,16733310-16733413,16734468-16734861, 16736291-16736901,16739238-16739289,16739771-16739826, 16739962-16740190,16740980-16741212,16741480-16741740 Length = 670 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +2 Query: 587 HSAAPPDSSG*TRAPPAIP 643 HSAAPP S T APP++P Sbjct: 317 HSAAPPPDSPSTAAPPSLP 335 >02_01_0075 - 522554-522616,522742-522748,523033-523136,523237-523368, 525209-525401,525978-526330,526693-526791,526864-526935, 527062-527213,527338-527386,527755-527885,528067-528307, 528392-528565,528656-528797,529236-529282,529370-529450, 530170-530271,530345-530440,531437-531444,531575-531616, 531830-531894,534761-534853,534888-534959,535303-535509, 536318-537226,537503-538158 Length = 1429 Score = 29.5 bits (63), Expect = 3.3 Identities = 20/79 (25%), Positives = 36/79 (45%) Frame = +3 Query: 423 RAPHHCTTHPKVTNIIINKLNWYKMCLMATLAATTPLRCRLHYCKLNSTVNVGGYTAPRP 602 + P +C TN++ NK+N + + L L +T R+ C ++ +V T+ +P Sbjct: 1158 QCPDNCFDITSKTNVLYNKINTFVVKLDKKLKMSTGSPERILLCNVDKSVGQCS-TSQKP 1216 Query: 603 RTVRGRHEHPPRSLTPGYA 659 + R P R T Y+ Sbjct: 1217 KHDLRRILQPARYYTDPYS 1235 >12_02_0509 - 19829360-19830400,19831475-19831821,19831920-19832073 Length = 513 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -2 Query: 606 SGGAALCSLPRLQLSLIYNSAIGSGGEWW 520 S G SL L SL +S+ GSG EWW Sbjct: 368 SAGGMAVSLLVLGFSLRVSSSSGSGSEWW 396 >01_01_0569 - 4214513-4214669,4215082-4216031,4216488-4216547 Length = 388 Score = 28.7 bits (61), Expect = 5.8 Identities = 19/41 (46%), Positives = 22/41 (53%) Frame = -2 Query: 648 G*GIAGGARVYPELSGGAALCSLPRLQLSLIYNSAIGSGGE 526 G G AG RV GGAAL ++PRL + L G GGE Sbjct: 46 GGGEAG--RVRGGGGGGAALFAVPRLFVGLAAKRGAGDGGE 84 >10_08_0772 + 20471748-20473004 Length = 418 Score = 28.3 bits (60), Expect = 7.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -3 Query: 305 STLLFICYIVILSCHISTRGCTPHTYVIMHSIERVQR 195 +TLL +C I + +C +STR + + +E+ R Sbjct: 6 TTLLVLCLIYVTTCSLSTRTAAFRAHDLRRGLEQAMR 42 >07_03_1559 + 27727492-27728193 Length = 233 Score = 28.3 bits (60), Expect = 7.6 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -2 Query: 636 AGGARVYPELSGGAALCSLPRLQLSLIYNSAIGSG-GEWWPPGL 508 AGG + G AALCS P L+ Y +G+ G W P L Sbjct: 156 AGGGGEGEDAHGAAALCSTPELRKH--YEQLVGAARGRPWSPRL 197 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,231,821 Number of Sequences: 37544 Number of extensions: 476487 Number of successful extensions: 1428 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1336 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1427 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2209429392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -