BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0953 (811 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF024494-13|AAB70328.1| 398|Caenorhabditis elegans Nuclear horm... 28 6.9 U41264-11|AAA82431.2| 550|Caenorhabditis elegans Hypothetical p... 28 9.1 >AF024494-13|AAB70328.1| 398|Caenorhabditis elegans Nuclear hormone receptor familyprotein 260 protein. Length = 398 Score = 28.3 bits (60), Expect = 6.9 Identities = 17/60 (28%), Positives = 29/60 (48%) Frame = +3 Query: 468 IINKLNWYKMCLMATLAATTPLRCRLHYCKLNSTVNVGGYTAPRPRTVRGRHEHPPRSLT 647 ++NK+ + + L + T RC YC+ +NVG RP +++ R PR L+ Sbjct: 69 VVNKMQYRCLREQKCLISFT-YRCACRYCRFQKCLNVG----MRPNSIQRRDLVGPRKLS 123 >U41264-11|AAA82431.2| 550|Caenorhabditis elegans Hypothetical protein F10E7.1 protein. Length = 550 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = -2 Query: 237 TYIRHYA*YRTRTTPVQLIRDNKIIFHRLLINPTVMVQGIVPI 109 T+ +A Y P+ + DN+II ++L N + V ++P+ Sbjct: 35 TFFTGFAMYLNNFDPINAVFDNEIILDKILNNVSKYVFPLIPL 77 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,243,764 Number of Sequences: 27780 Number of extensions: 399905 Number of successful extensions: 906 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 906 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1987863822 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -