BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0952 (755 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_O42651 Cluster: Autophagy-related protein 17; n=1; Schi... 38 0.35 >UniRef50_O42651 Cluster: Autophagy-related protein 17; n=1; Schizosaccharomyces pombe|Rep: Autophagy-related protein 17 - Schizosaccharomyces pombe (Fission yeast) Length = 481 Score = 37.5 bits (83), Expect = 0.35 Identities = 21/75 (28%), Positives = 34/75 (45%) Frame = +3 Query: 57 VLVLYEFFRKNSNTNSLRITNIFTYMRY*LAATQRFSID*KQ*CQLLGSAHQFNKSQMSA 236 ++ LY FF +T ++ + M TQ+ Q QL G AH+FN+ + Sbjct: 46 LIYLYSFFSSGVHTRGIQFYRVSAVMELLQQWTQQAKAALTQARQLCGDAHKFNEDAKTD 105 Query: 237 LHNQLQNHMILHLIA 281 L N ++ H L +A Sbjct: 106 LRNSIKQHQQLKELA 120 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 619,860,126 Number of Sequences: 1657284 Number of extensions: 11233196 Number of successful extensions: 18152 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 17629 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18148 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 62558016040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -