BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0951 (501 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC24B11.07c |||ketopantoate reductase |Schizosaccharomyces pom... 29 0.52 SPBC25H2.03 |||vacuolar protein involved in phosphoinositide met... 29 0.52 SPCC1919.05 |||TPR repeat protein Ski3 |Schizosaccharomyces pomb... 25 4.8 SPBC800.03 |clr3||histone deacetylase |Schizosaccharomyces pombe... 25 4.8 SPAPB24D3.04c |mag1||DNA-3-methyladenine glycosylase Mag1|Schizo... 25 4.8 SPBP35G2.05c |cki2||serine/threonine protein kinase Cki2|Schizos... 25 8.4 >SPAC24B11.07c |||ketopantoate reductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 561 Score = 28.7 bits (61), Expect = 0.52 Identities = 17/62 (27%), Positives = 27/62 (43%) Frame = +2 Query: 92 PFDLLLAEPAFPRCKPAPDDSVLTQALLKRHTELCPSPTDQAAVLSLVTKLQTVLDNIVV 271 P +L P P+ PD + L Q +L+ LC V L + +T+L ++ V Sbjct: 213 PLTVLTQNPNLPKLLERPDINDLHQGILQELDSLCNCLGSSLDVKKLSKQRETLLSHMQV 272 Query: 272 AP 277 P Sbjct: 273 NP 274 >SPBC25H2.03 |||vacuolar protein involved in phosphoinositide metabolism|Schizosaccharomyces pombe|chr 2|||Manual Length = 811 Score = 28.7 bits (61), Expect = 0.52 Identities = 20/41 (48%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 321 PTCRTSSSWQAANSPGATTILSNTVCSFVTRL-KTAA*SVG 202 PT T S+ +A+ G TT SN+ SF+TRL TAA S G Sbjct: 766 PTATTISTTTSAS--GITTTASNSRDSFITRLPPTAALSTG 804 >SPCC1919.05 |||TPR repeat protein Ski3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 1389 Score = 25.4 bits (53), Expect = 4.8 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = -3 Query: 487 RAHXCTAAFSIHQLVHLLVNLIGESLDSLFRWQSFHD 377 R AA S+ + + + N++ E + S+F W+ D Sbjct: 772 RGFYSRAADSLEKSIQICCNVLKEDITSIFSWEILGD 808 >SPBC800.03 |clr3||histone deacetylase |Schizosaccharomyces pombe|chr 2|||Manual Length = 687 Score = 25.4 bits (53), Expect = 4.8 Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 3/84 (3%) Frame = +1 Query: 43 DGASTLQQTPSLDASSALRPFISRTRFS*MQTGSRRLRAHSGPSKEAHGAMSVTYRSSSC 222 DGAST + PS DA + + P+ + +GS + E+H + +S C Sbjct: 7 DGASTSVK-PSDDAVNTVTPWSILLTNNKPMSGSENTL-----NNESHEMSQILKKSGLC 60 Query: 223 FEPR---HETADSIGQYCCGSRRI 285 ++PR H T + + RR+ Sbjct: 61 YDPRMRFHATLSEVDDHPEDPRRV 84 >SPAPB24D3.04c |mag1||DNA-3-methyladenine glycosylase Mag1|Schizosaccharomyces pombe|chr 1|||Manual Length = 228 Score = 25.4 bits (53), Expect = 4.8 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = +2 Query: 275 PGEFAACQLEEVRQVGSYKKGTMMAGKNVADIVVIMKTLPTKEAVEGLSNKVNEEVNKLM 454 P E E +R G + + + K++A+ I +PTKE E LSN+ E + +L Sbjct: 87 PEEIRDMDFEIMRACG-FSARKIDSLKSIAE-ATISGLIPTKEEAERLSNE--ELIERLT 142 Query: 455 NAEGSG 472 +G G Sbjct: 143 QIKGIG 148 >SPBP35G2.05c |cki2||serine/threonine protein kinase Cki2|Schizosaccharomyces pombe|chr 2|||Manual Length = 435 Score = 24.6 bits (51), Expect = 8.4 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = -3 Query: 439 LLVNLIGESLDSLFRW 392 L+++L+G SL+ LF W Sbjct: 83 LVIDLLGPSLEDLFEW 98 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,988,204 Number of Sequences: 5004 Number of extensions: 40405 Number of successful extensions: 108 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 108 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 198176188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -