BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0949 (568 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC959.03c |||U3 snoRNP-associated protein Utp7|Schizosaccharom... 29 0.48 SPCC1494.07 |||conserved eukaryotic protein|Schizosaccharomyces ... 25 7.7 >SPAC959.03c |||U3 snoRNP-associated protein Utp7|Schizosaccharomyces pombe|chr 1|||Manual Length = 520 Score = 29.1 bits (62), Expect = 0.48 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +3 Query: 147 NGCYYTYKPSSSITLSIKKTHQNPLRSFKDLSIHRDGQ 260 NG + PSS+ L TH+ P+R DL+++RDG+ Sbjct: 244 NGQVTLWSPSSTTPLVKMLTHRGPVR---DLAVNRDGR 278 >SPCC1494.07 |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1502 Score = 25.0 bits (52), Expect = 7.7 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +3 Query: 114 NCNLLLISPLFNGCYYTYKPSSSITLSIKK 203 NC+++L + L N + + KP ++ L K Sbjct: 871 NCSVMLFTALINRAFGSKKPKDAVNLGNNK 900 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,989,321 Number of Sequences: 5004 Number of extensions: 37627 Number of successful extensions: 65 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 240047038 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -