BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0949 (568 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31322| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_28690| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_5677| Best HMM Match : fn3 (HMM E-Value=0.0092) 27 8.1 >SB_31322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 563 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 147 NGCYYTYKPSSSITLSIKKTHQNPLRSFKDLSIHR 251 +G Y T+KP +S KT+ P + F + SIHR Sbjct: 228 HGDYRTWKPEPLEKISRSKTYAPPEQPFNETSIHR 262 >SB_28690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2179 Score = 28.3 bits (60), Expect = 4.6 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 117 CNLLLISPLFNGCYYTYKP 173 CN +P+++GCYY Y P Sbjct: 527 CNTPPTNPIYDGCYYHYLP 545 >SB_5677| Best HMM Match : fn3 (HMM E-Value=0.0092) Length = 1146 Score = 27.5 bits (58), Expect = 8.1 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -2 Query: 120 YSFRSEARAGR*IINKIQNTQQ 55 Y+ + EARAGR ++ +Q TQQ Sbjct: 795 YAQQQEARAGRPVVQVVQQTQQ 816 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,643,117 Number of Sequences: 59808 Number of extensions: 242240 Number of successful extensions: 598 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 597 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1337207630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -