BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0948 (688 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC025721-12|AAK29899.1| 278|Caenorhabditis elegans Hypothetical... 28 5.4 U10438-12|ABB88244.1| 325|Caenorhabditis elegans Hypothetical p... 27 9.5 U10438-11|AAL50321.1| 335|Caenorhabditis elegans Hypothetical p... 27 9.5 >AC025721-12|AAK29899.1| 278|Caenorhabditis elegans Hypothetical protein Y48G8AL.13 protein. Length = 278 Score = 28.3 bits (60), Expect = 5.4 Identities = 8/20 (40%), Positives = 17/20 (85%) Frame = -2 Query: 315 YNILYNLGYFKYDVIDLYVN 256 Y L+++GYF YD++D++++ Sbjct: 81 YVFLFSMGYFIYDLLDMHIH 100 >U10438-12|ABB88244.1| 325|Caenorhabditis elegans Hypothetical protein B0280.1b protein. Length = 325 Score = 27.5 bits (58), Expect = 9.5 Identities = 16/60 (26%), Positives = 29/60 (48%) Frame = -1 Query: 670 KIMHKRYIKSIKKTLHTPHTMYLRHTRMHTIYCQTFVLDVCGQIENRLNIVCLF*YFL*C 491 K +H +I +K ++ H + H R+ IY +D+ Q+E R++ + Y L C Sbjct: 26 KDLHANFINQYEKNKNSYHYIMAEHLRVSGIYWCVNAMDLSKQLE-RMSTEEIVNYVLGC 84 >U10438-11|AAL50321.1| 335|Caenorhabditis elegans Hypothetical protein B0280.1a protein. Length = 335 Score = 27.5 bits (58), Expect = 9.5 Identities = 16/60 (26%), Positives = 29/60 (48%) Frame = -1 Query: 670 KIMHKRYIKSIKKTLHTPHTMYLRHTRMHTIYCQTFVLDVCGQIENRLNIVCLF*YFL*C 491 K +H +I +K ++ H + H R+ IY +D+ Q+E R++ + Y L C Sbjct: 26 KDLHANFINQYEKNKNSYHYIMAEHLRVSGIYWCVNAMDLSKQLE-RMSTEEIVNYVLGC 84 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,297,617 Number of Sequences: 27780 Number of extensions: 251655 Number of successful extensions: 512 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 512 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1571291122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -