BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0945 (803 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF040643-1|AAB94960.1| 998|Caenorhabditis elegans Hypothetical ... 29 3.9 Z78199-1|CAB01576.2| 1969|Caenorhabditis elegans Hypothetical pr... 28 6.8 X08067-1|CAA30856.1| 1969|Caenorhabditis elegans myosin heavy ch... 28 6.8 >AF040643-1|AAB94960.1| 998|Caenorhabditis elegans Hypothetical protein F14D2.6 protein. Length = 998 Score = 29.1 bits (62), Expect = 3.9 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -2 Query: 784 LTHGGNRNYALTKQNKKNTISVYELTIIKHEASCGNMSFIES 659 L + N Y L N KNT +Y L ++K A N+ F+E+ Sbjct: 822 LINATNEEYVL---NLKNTKVIYGLLVVKSTAKLENLDFLEN 860 >Z78199-1|CAB01576.2| 1969|Caenorhabditis elegans Hypothetical protein K12F2.1 protein. Length = 1969 Score = 28.3 bits (60), Expect = 6.8 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = -2 Query: 244 SPSFAPTTHVLRLKFVNIIQMLYVIFFQVLRCTRPPEFGRSISRIVDS 101 S SFA + + R N++ MLY +RC P E + S ++DS Sbjct: 653 SSSFATVSMIYRESLNNLMNMLYQTHPHFIRCIIPNE--KKASGVIDS 698 >X08067-1|CAA30856.1| 1969|Caenorhabditis elegans myosin heavy chain 3 protein. Length = 1969 Score = 28.3 bits (60), Expect = 6.8 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = -2 Query: 244 SPSFAPTTHVLRLKFVNIIQMLYVIFFQVLRCTRPPEFGRSISRIVDS 101 S SFA + + R N++ MLY +RC P E + S ++DS Sbjct: 653 SSSFATVSMIYRESLNNLMNMLYQTHPHFIRCIIPNE--KKASGVIDS 698 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,417,449 Number of Sequences: 27780 Number of extensions: 347270 Number of successful extensions: 885 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 857 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 884 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1966828226 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -