BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0943 (799 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical pro... 23 3.7 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 22 4.9 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 8.6 >AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical protein protein. Length = 102 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -3 Query: 92 NNFIKS*NCPWTSPHTVTGESISIIVF 12 +NF K NC +TS H + S+ + F Sbjct: 17 SNFSKFINCHYTSGHLLGSSSLPLRSF 43 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 22.2 bits (45), Expect = 4.9 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +1 Query: 562 FYSYAACCDFL 594 F+ +A CCDF+ Sbjct: 75 FFFFAICCDFI 85 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 8.6 Identities = 10/39 (25%), Positives = 17/39 (43%) Frame = +1 Query: 211 KTLFLLRGNHECRHLTEYFTFKQECKIKYSEKVYDACMD 327 +TL+ L N+E RH + + F + + MD Sbjct: 402 RTLYKLPPNYEIRHKFKLWNFNNQISDDNPARFLQKAMD 440 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,603 Number of Sequences: 336 Number of extensions: 4583 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21687721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -