BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0937 (756 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1450.09c |||phospholipase |Schizosaccharomyces pombe|chr 3||... 29 0.54 SPBC800.03 |clr3||histone deacetylase |Schizosaccharomyces pombe... 27 2.9 SPBC336.15 |pic1|SPBC685.01|INCENP-like|Schizosaccharomyces pomb... 27 3.8 SPBC83.18c |||C2 domain protein|Schizosaccharomyces pombe|chr 2|... 27 3.8 SPBC2F12.02c |mrpl7||mitochondrial ribosomal protein subunit L7|... 27 3.8 SPBC2D10.18 |abc1|coq8|ABC1 kinase family protein|Schizosaccharo... 26 5.0 SPBC1271.12 |kes1||oxysterol binding protein |Schizosaccharomyce... 26 6.7 SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|c... 25 8.8 >SPCC1450.09c |||phospholipase |Schizosaccharomyces pombe|chr 3|||Manual Length = 633 Score = 29.5 bits (63), Expect = 0.54 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = -1 Query: 384 SDQDMNGIASPS---RPAEIMPLSQRTQKPRYSP 292 SD ++ G+ P +PA +PLS+R+ P Y+P Sbjct: 30 SDPELIGLLKPDNVDKPANSIPLSKRSTSPSYAP 63 >SPBC800.03 |clr3||histone deacetylase |Schizosaccharomyces pombe|chr 2|||Manual Length = 687 Score = 27.1 bits (57), Expect = 2.9 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = +3 Query: 255 IRLKLKAPEFLTEGNIVVFGFVGIAALSPLDARVKLFHSYLGLIPNLSQFTTSE 416 + L + F G V G V +A+ + RVK ++LG P + T SE Sbjct: 564 VELSISKNIFFIGGGKAVHGLVNLASSRNVSDRVKCMVNFLGTEPLVGLKTASE 617 >SPBC336.15 |pic1|SPBC685.01|INCENP-like|Schizosaccharomyces pombe|chr 2|||Manual Length = 1018 Score = 26.6 bits (56), Expect = 3.8 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Frame = -3 Query: 343 SGDNAAIPTNPKT-----TIFPSVKNSGAFNFNLIGLGSIFPDDALSVSPASNHHLI 188 S + IP+ P T + + KNS A + +L + +D S+SPA +H +I Sbjct: 449 SSNKRLIPSTPPTKKPINAVLDAAKNSAAKDLHLAKMKLNNKNDESSLSPAKSHAVI 505 >SPBC83.18c |||C2 domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 272 Score = 26.6 bits (56), Expect = 3.8 Identities = 17/62 (27%), Positives = 29/62 (46%) Frame = -1 Query: 360 ASPSRPAEIMPLSQRTQKPRYSPPLRIPGLSISTLSGLVLFFLMTLLAFPQPPIITSYIG 181 + PS+P + +P+S +PP R +S+ S L + L +FP P ++ Y Sbjct: 160 SKPSKPRKKVPVSHPLPP---TPPSREEHVSVPRESSLFTYEDDPLPSFPSPYMVDDYYT 216 Query: 180 SD 175 D Sbjct: 217 QD 218 >SPBC2F12.02c |mrpl7||mitochondrial ribosomal protein subunit L7|Schizosaccharomyces pombe|chr 2|||Manual Length = 287 Score = 26.6 bits (56), Expect = 3.8 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 5/64 (7%) Frame = -1 Query: 390 SGSDQDMNGIASPSRPAEIMPLSQRTQKPRYSPPLRIPGLSISTLSG-----LVLFFLMT 226 S + D G S P+E+MPL + + P +PG +++ + L FF+ + Sbjct: 214 SPTSGDQTGNISFGLPSEVMPLFPQIEAVYEMYPHSLPGFNVNITTNSKDTRLARFFVSS 273 Query: 225 LLAF 214 L+ F Sbjct: 274 LIPF 277 >SPBC2D10.18 |abc1|coq8|ABC1 kinase family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 610 Score = 26.2 bits (55), Expect = 5.0 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -2 Query: 674 GSWHLREQHEPHTEVLLSSPVLPQRRQEV 588 G HL+EQ + +S P+LP ++ E+ Sbjct: 98 GVKHLQEQSSKEIKNPISQPILPNKKDEI 126 >SPBC1271.12 |kes1||oxysterol binding protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 388 Score = 25.8 bits (54), Expect = 6.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 701 NHEKERVYQGSWHLREQHEPHTEV 630 + EK ++ +G LR Q E H EV Sbjct: 330 SQEKSKIEEGQRELRRQEEEHNEV 353 >SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 796 Score = 25.4 bits (53), Expect = 8.8 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = -1 Query: 309 KPRYSPPLRIPGLSISTLSGLVLFFLMTLLAFPQPPIITSYIGSD 175 K Y+P I GL++ TLS +LM L+ P ++ + G D Sbjct: 50 KVLYAPRTTIEGLNLPTLSSSYYKWLMDLVNIPD-DVVQNCAGLD 93 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,063,032 Number of Sequences: 5004 Number of extensions: 65786 Number of successful extensions: 204 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 199 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 204 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 361294920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -