BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0936 (541 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 154 2e-39 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 25 2.1 AJ439060-13|CAD27764.1| 319|Anopheles gambiae putative transcri... 24 2.8 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 24 3.7 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 24 3.7 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 24 3.7 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 24 3.7 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 24 3.7 EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. 24 3.7 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 24 3.7 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 24 3.7 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 24 3.7 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 24 3.7 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 24 3.7 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 24 3.7 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 24 3.7 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 24 3.7 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 24 3.7 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 24 3.7 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 24 3.7 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 24 3.7 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 24 3.7 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 24 3.7 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 24 3.7 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 24 3.7 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 24 3.7 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 24 3.7 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 24 3.7 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 24 3.7 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 24 3.7 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 24 3.7 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 24 3.7 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 24 3.7 AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. 24 3.7 AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. 24 3.7 AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. 24 3.7 AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. 24 3.7 AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. 24 3.7 AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. 24 3.7 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 8.7 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 154 bits (374), Expect = 2e-39 Identities = 81/171 (47%), Positives = 108/171 (63%), Gaps = 1/171 (0%) Frame = -2 Query: 534 LTQTDYTHRHNQLANIIHQQLALKHKLIQNTNTPYYNYKPQTVLENDSCKLYYDRAILTD 355 L + Y RHN +A I+HQQLAL+HKL++ P Y Y P V END KLY+DR I+TD Sbjct: 1037 LAGSAYLDRHNDVAKIVHQQLALRHKLVERF-LPCYRYLPDPVQENDCIKLYWDREIITD 1095 Query: 354 RTIHYNRPDITLQDKNNK-VTYIIDIAVPNTHNIQKTFTEKMTKYTELKEEIVRIWKQKK 178 I NRPDI + +K K T IDIAV HN+Q TF+ K+ KY +L EE+ + W + Sbjct: 1096 ILIRANRPDILVYEKRKKRATIDIDIAVTLDHNVQTTFSTKVMKYHDLAEELKQTWYLED 1155 Query: 177 AYIVPIIISTTGVVPNHIHNSLKLLDLKDNIFISLQKAAILNTCRIVRKFM 25 IVP+IIS TG+VP + SL L+L+ + +QKA IL TC +R+F+ Sbjct: 1156 IRIVPVIISATGIVPMALLRSLDELELQREL-PRIQKAVILRTCSTLRRFL 1205 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 24.6 bits (51), Expect = 2.1 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 166 PNNNLNHWSCSKPHPQQL 113 P N LNHW + H Q + Sbjct: 1623 PTNRLNHWRLIQKHMQHI 1640 >AJ439060-13|CAD27764.1| 319|Anopheles gambiae putative transcription factor protein. Length = 319 Score = 24.2 bits (50), Expect = 2.8 Identities = 12/39 (30%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = -2 Query: 288 IDIAVPNTHNIQKTFTEKMTKYTELKEEIVRIW-KQKKA 175 ++ TH EK+ +LKEE V +W K ++A Sbjct: 202 LEATFDKTHYPDVLLREKLAIKVDLKEERVEVWFKNRRA 240 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 109 ETLHAANNNISRVSCSR 125 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 124 ETLHAANNNISRVSCSR 140 >AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 49 ETLHAANNNISRVSCSR 65 >AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 49 ETLHAANNNISRVSCSR 65 >AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 49 ETLHAANNNISRVSCSR 65 >AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 49 ETLHAANNNISRVSCSR 65 >AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 49 ETLHAANNNISRVSCSR 65 >AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 181 KSIHSPNNNLNHWSCSK 131 +++H+ NNN++ SCS+ Sbjct: 49 ETLHAANNNISRVSCSR 65 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 22.6 bits (46), Expect = 8.7 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = -2 Query: 147 TGVVPNHIHNSLKLLDLKDNIFISLQKAAILNTCRIVR 34 T V P I NS++ L L DN + ++ + + R Sbjct: 642 TRVTPATIPNSIEFLFLNDNHIVHVEPHCFTHKTNLTR 679 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 548,031 Number of Sequences: 2352 Number of extensions: 10763 Number of successful extensions: 72 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 50320221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -