BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0935 (323 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0261 + 13586474-13587833,13591621-13591707,13591932-13591960 27 4.5 02_05_0659 + 30679809-30680253,30680699-30680715,30682373-306825... 26 7.8 >04_03_0261 + 13586474-13587833,13591621-13591707,13591932-13591960 Length = 491 Score = 26.6 bits (56), Expect = 4.5 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +1 Query: 109 MNVHVDAKSIYIKMNCC-SLVSLKLENGWTD 198 M ++ KS + K++C L+ LK NGW+D Sbjct: 152 MPLYDGCKSKHSKLSCVLELMKLKASNGWSD 182 >02_05_0659 + 30679809-30680253,30680699-30680715,30682373-30682530, 30682570-30682846 Length = 298 Score = 25.8 bits (54), Expect = 7.8 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -1 Query: 257 CLRLNLLWTSTNNSRPKLAKSVQP 186 CL LW ST + P L +S P Sbjct: 6 CLACRFLWRSTPSPHPALGRSTTP 29 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,673,642 Number of Sequences: 37544 Number of extensions: 127327 Number of successful extensions: 264 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 261 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 264 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 423156300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -