BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0933 (667 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0438 - 17737040-17737122,17737373-17737496,17737897-177381... 29 3.3 10_01_0168 - 1883380-1883594,1884572-1888325 29 3.3 >11_04_0438 - 17737040-17737122,17737373-17737496,17737897-17738182, 17738265-17738397,17738742-17738953,17739455-17739816, 17739907-17739937,17744738-17745111 Length = 534 Score = 29.1 bits (62), Expect = 3.3 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = +1 Query: 196 NCCREPNNHVNISLSIKYMYFLHGYQVSSQSDARFSSYNGASVKTTVYLYNSIDSLVFK 372 N REPN +N ++FL Y V+ + D Y+GA K TV ++ L+ K Sbjct: 426 NKSREPNKEINDKSLYNSLFFLRVYMVAHRDDL-IKGYSGA--KETVEDRKAVVRLLMK 481 >10_01_0168 - 1883380-1883594,1884572-1888325 Length = 1322 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +2 Query: 368 LKLFTHLLQSKMISNI--LCRVKGQLEARQSRVADHCSR 478 L H L+ +I LC V GQL+A + + DHC++ Sbjct: 1134 LDALNHSLKKLLIFGCEKLCSVSGQLDALKRLIIDHCNK 1172 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,631,633 Number of Sequences: 37544 Number of extensions: 247086 Number of successful extensions: 317 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 312 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 317 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1679486824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -