BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0931 (693 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0227 - 18425790-18425890,18426046-18426114,18426296-18426533 28 6.1 06_03_0222 - 18378892-18378992,18379106-18379174,18379356-18379593 28 6.1 >06_03_0227 - 18425790-18425890,18426046-18426114,18426296-18426533 Length = 135 Score = 28.3 bits (60), Expect = 6.1 Identities = 19/57 (33%), Positives = 24/57 (42%), Gaps = 2/57 (3%) Frame = -3 Query: 622 MNSVSSMINCFFVFEL--QAMKISYALI*SLTSKVFKNSYNICRTSFNRSFTCSHIS 458 M V S+I C V L Q KI S +N YN CR + TC+ +S Sbjct: 1 MEGVKSLIMCMLVLGLVLQQEKIQVEAKSCCPSTTARNVYNSCRFAGGSRDTCAKLS 57 >06_03_0222 - 18378892-18378992,18379106-18379174,18379356-18379593 Length = 135 Score = 28.3 bits (60), Expect = 6.1 Identities = 19/57 (33%), Positives = 24/57 (42%), Gaps = 2/57 (3%) Frame = -3 Query: 622 MNSVSSMINCFFVFEL--QAMKISYALI*SLTSKVFKNSYNICRTSFNRSFTCSHIS 458 M V S+I C V L Q KI S +N YN CR + TC+ +S Sbjct: 1 MEGVKSLIMCMLVLGLVLQQEKIQVEAKSCCPSTTARNVYNSCRFAGGSRNTCAKLS 57 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,550,655 Number of Sequences: 37544 Number of extensions: 185109 Number of successful extensions: 392 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 392 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -