BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0931 (693 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 23 2.8 DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 23 3.6 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 23 3.6 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 22 4.8 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 22 4.8 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 22 4.8 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 22 4.8 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 22 4.8 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 22 4.8 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 22 4.8 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 8.4 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 Query: 205 KAISNHKRHRNNKITNYKIL 146 K I N+ + NN NYK L Sbjct: 88 KTIHNNNNYNNNNYNNYKKL 107 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = -3 Query: 265 CSNKLSLKTLMLVFMLGSICKAISNHKRHRNNKITNY 155 C+N+ +L L + C + ++H NK+ NY Sbjct: 53 CTNEGRELKKILPDALSTGCNKCNEKQKHTANKVVNY 89 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = -3 Query: 265 CSNKLSLKTLMLVFMLGSICKAISNHKRHRNNKITNY 155 C+N+ +L L + C + ++H NK+ NY Sbjct: 53 CTNEGRELKKILPDALSTGCNKCNEKQKHTANKVVNY 89 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 196 SNHKRHRNNKITNYKIL 146 SN+ + NN TNYK L Sbjct: 92 SNYNNYNNNYNTNYKKL 108 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 196 SNHKRHRNNKITNYKIL 146 SN+ + NN TNYK L Sbjct: 92 SNYNNYNNNYNTNYKKL 108 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 196 SNHKRHRNNKITNYKIL 146 SN+ + NN TNYK L Sbjct: 92 SNYNNYNNNYNTNYKKL 108 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 196 SNHKRHRNNKITNYKIL 146 SN+ + NN TNYK L Sbjct: 92 SNYNNYNNNYNTNYKKL 108 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 196 SNHKRHRNNKITNYKIL 146 SN+ + NN TNYK L Sbjct: 92 SNYNNYNNNYNTNYKKL 108 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 196 SNHKRHRNNKITNYKIL 146 SN+ + NN TNYK L Sbjct: 92 SNYNNYNNNYNTNYKKL 108 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 196 SNHKRHRNNKITNYKIL 146 SN+ + NN TNYK L Sbjct: 92 SNYNNYNNNYNTNYKKL 108 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 211 ICKAISNHKRHRNNKITNY 155 I ++SN H NN NY Sbjct: 303 IISSLSNKTIHNNNNYNNY 321 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,139 Number of Sequences: 438 Number of extensions: 2672 Number of successful extensions: 15 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -