BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0929 (795 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 26 1.2 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 26.2 bits (55), Expect = 1.2 Identities = 23/85 (27%), Positives = 29/85 (34%) Frame = +1 Query: 451 PAAQPEDSKTEVQATVAEISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAI 630 PA T A A + AT A + + A A T + A A Sbjct: 182 PAVPAAPVATAALAATAFAATNAASVATAAPAAITAPAANAASTAAAPAAATAHA-ATAS 240 Query: 631 PEIKTPEAADAPKLADNPVDEDKPA 705 P AA AP P+D+D PA Sbjct: 241 PVATAALAAGAPATVSTPMDKDDPA 265 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.312 0.129 0.353 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 576,917 Number of Sequences: 2352 Number of extensions: 9081 Number of successful extensions: 6 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83576403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -