BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0922 (743 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39678-10|AAV28360.1| 436|Caenorhabditis elegans Hypothetical p... 31 1.1 AL021175-1|CAA15965.1| 307|Caenorhabditis elegans Hypothetical ... 28 8.0 >U39678-10|AAV28360.1| 436|Caenorhabditis elegans Hypothetical protein C39D10.11 protein. Length = 436 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = -1 Query: 731 KSIIPTVNSDEYL*LGRAVCSISTTRETCAYFVSVISSPK 612 K ++P NS E G C IS TC Y I +PK Sbjct: 261 KCVVPIQNSCEPFLWGNNACIISRDNPTCFYLAHTILNPK 300 >AL021175-1|CAA15965.1| 307|Caenorhabditis elegans Hypothetical protein Y6E2A.1 protein. Length = 307 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -1 Query: 98 GVKL*LLCLNFKQYYVNITDNNKKSRFSI 12 G+ L LL +NF Y+++T +K SRFS+ Sbjct: 58 GMMLSLLTINFYYRYLSVTCPSKLSRFSL 86 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,365,913 Number of Sequences: 27780 Number of extensions: 302278 Number of successful extensions: 558 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 558 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1756472266 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -