BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0919 (722 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 23 1.9 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 23 2.5 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 4.4 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 22 5.8 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 7.6 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +2 Query: 47 PPDLTIESQKVVTSSNRPPIIRETGPRECEDK 142 PP + ++ V T S PP+ ++ + CE++ Sbjct: 736 PPRVESFAETVRTVSKIPPLYKDLVAKRCEER 767 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 23.0 bits (47), Expect = 2.5 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +2 Query: 545 ISYINVIIFRFIMTFRYYSILNYRKKKLELVNVIC 649 I ++++I RF++ RY + K ELV +C Sbjct: 179 IEFVSIIRNRFVILNRYIEESISKYKHAELVMPLC 213 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.2 bits (45), Expect = 4.4 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = +2 Query: 518 SMCIIFEIPISYINVIIFRFIMTFRYYSILNYRKKKLELVNVICLLV*YLM 670 S IIF I + + V+I + + YY+ + + + L+ ++C+ Y M Sbjct: 217 SAFIIFTIHLLFYCVLIILLCIYYFYYAFILF---TVHLLLLVCIYYFYYM 264 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 147 TTVSWRFKLAFVIITST 197 +T SW F F+++TST Sbjct: 98 STFSWTFIDVFIMLTST 114 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/28 (25%), Positives = 14/28 (50%) Frame = -1 Query: 503 FIKITDKNHGRVNLYYQIRFSTLQNIYE 420 FI I +NH + ++ I +++E Sbjct: 308 FINIDPENHNKTEIFLNITGDKTNSVFE 335 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,080 Number of Sequences: 336 Number of extensions: 2970 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19259425 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -