BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0919 (722 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 2.4 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 23 7.2 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 25.0 bits (52), Expect = 2.4 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -2 Query: 166 NRQETVV---QFIFAFSRSGFSNNGRPITRSNDFLRFDSQIWR 47 N +TVV QF S+ G N + N L FD Q W+ Sbjct: 1035 NISQTVVSKAQFAMDLSQFGVLTNQHGVVTGNVQLSFDGQTWQ 1077 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 23.4 bits (48), Expect = 7.2 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -3 Query: 159 RKQLFSLSSHSLGPVSLIMGGRLLE 85 R++ S ++ PVS+++ GRLLE Sbjct: 427 RREFLSKNATFSRPVSVVLKGRLLE 451 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 605,053 Number of Sequences: 2352 Number of extensions: 10784 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -