BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0916 (833 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 24 2.0 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 2.6 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +3 Query: 69 KKTGCVTFRKQYHRLYYTQTDMLPIVRVC 155 KK C +RK Y+ + Y + +P+ C Sbjct: 97 KKLYCNNYRKLYYNINYIEQIPIPVPIYC 125 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 23.4 bits (48), Expect = 2.6 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = -3 Query: 627 HKKKI--TFHLFVIS*VFCLYFFNGKTMLSLGQNASERNFDFFSY 499 H+K I TFHL V+ L+ N ++++ + + + FD +Y Sbjct: 137 HRKLIAPTFHLNVLKSFIDLFNANARSVVEKMRKENGKEFDCHNY 181 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 219,389 Number of Sequences: 438 Number of extensions: 4606 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26702940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -