BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0914 (825 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 24 2.0 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 23 2.6 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 23 2.6 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 23 2.6 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 7.9 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 7.9 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 7.9 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 7.9 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 7.9 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 7.9 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 7.9 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 7.9 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 7.9 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.8 bits (49), Expect = 2.0 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -2 Query: 617 QKHSNLQNYCLSVTALSLKNLTKIFL*SNKVGKYYLD 507 Q H N L +LKN + L ++++G+ YLD Sbjct: 1014 QIHPKTLNEVLQADMNALKNFNQPLLVNDQLGQLYLD 1050 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 23.4 bits (48), Expect = 2.6 Identities = 10/36 (27%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +3 Query: 384 LADYKATLPILKSYPKVTVEVKWEL-QSEHGDLVCV 488 + D+ TLP+ + P++ + +W++ E G L+ V Sbjct: 497 MIDFAKTLPLPQHLPRIHHDAEWKVGNHEDGYLIGV 532 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 23.4 bits (48), Expect = 2.6 Identities = 10/36 (27%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +3 Query: 384 LADYKATLPILKSYPKVTVEVKWEL-QSEHGDLVCV 488 + D+ TLP+ + P++ + +W++ E G L+ V Sbjct: 412 MIDFAKTLPLPQHLPRIHHDAEWKVGNHEDGYLIGV 447 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 23.4 bits (48), Expect = 2.6 Identities = 10/36 (27%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +3 Query: 384 LADYKATLPILKSYPKVTVEVKWEL-QSEHGDLVCV 488 + D+ TLP+ + P++ + +W++ E G L+ V Sbjct: 731 MIDFAKTLPLPQHLPRIHHDAEWKVGNHEDGYLIGV 766 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.8 bits (44), Expect = 7.9 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +3 Query: 42 FIDPNLILSTKMLFFITAAVLLASAEA 122 F NLIL T ++ F+ V AEA Sbjct: 235 FYTVNLILPTVLISFLCVLVFYLPAEA 261 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 176 ERMRRVVQSLYTEEKHRRHDR 238 ER+RR + + +E+ R H+R Sbjct: 34 ERLRRRREWMIQQEREREHER 54 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 176 ERMRRVVQSLYTEEKHRRHDR 238 ER+RR + + +E+ R H+R Sbjct: 34 ERLRRRREWMIQQEREREHER 54 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 176 ERMRRVVQSLYTEEKHRRHDR 238 ER+RR + + +E+ R H+R Sbjct: 34 ERLRRRREWMIQQEREREHER 54 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 176 ERMRRVVQSLYTEEKHRRHDR 238 ER+RR + + +E+ R H+R Sbjct: 34 ERLRRRREWMIQQEREREHER 54 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 176 ERMRRVVQSLYTEEKHRRHDR 238 ER+RR + + +E+ R H+R Sbjct: 34 ERLRRRREWMIQQEREREHER 54 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 176 ERMRRVVQSLYTEEKHRRHDR 238 ER+RR + + +E+ R H+R Sbjct: 34 ERLRRRREWMIQQEREREHER 54 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.8 bits (44), Expect = 7.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 176 ERMRRVVQSLYTEEKHRRHDR 238 ER+RR + + +E+ R H+R Sbjct: 34 ERLRRRREWMIQQEREREHER 54 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.8 bits (44), Expect = 7.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 176 ERMRRVVQSLYTEEKHRRHDR 238 ER+RR + + +E+ R H+R Sbjct: 34 ERLRRRREWMIQQEREREHER 54 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,250 Number of Sequences: 438 Number of extensions: 4326 Number of successful extensions: 18 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26338809 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -