BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0914 (825 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g48550.1 68416.m05301 expressed protein putative zinc-finger ... 31 0.70 At4g31420.2 68417.m04461 zinc finger (C2H2 type) family protein ... 31 1.2 At4g31420.1 68417.m04460 zinc finger (C2H2 type) family protein ... 31 1.2 At2g42140.1 68415.m05216 VQ motif-containing protein contains PF... 31 1.2 At2g38660.1 68415.m04748 tetrahydrofolate dehydrogenase/cyclohyd... 31 1.2 At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family... 29 2.8 At5g47430.1 68418.m05844 expressed protein 29 3.7 At4g33120.1 68417.m04718 coclaurine N-methyltransferase, putativ... 29 3.7 At2g04620.1 68415.m00470 cation efflux family protein potential ... 29 3.7 At1g04530.1 68414.m00445 expressed protein 29 3.7 At1g22800.1 68414.m02848 expressed protein similar to Biotin syn... 29 5.0 At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 28 6.5 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 28 6.5 At3g45210.1 68416.m04879 expressed protein contains Pfam profile... 28 8.7 At2g46710.1 68415.m05828 rac GTPase activating protein, putative... 28 8.7 >At3g48550.1 68416.m05301 expressed protein putative zinc-finger protein - Arabidopsis thaliana,PID:g4406777 Length = 158 Score = 31.5 bits (68), Expect = 0.70 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +2 Query: 164 QRDGERMRRVVQSLYTEEKHRRHDRPAVYTTAQHRSHKYRSSRGHHE 304 Q+D + +++ S + E R RP V TT H +H SS HH+ Sbjct: 4 QQDHHKELQLLPSPPSTESPVRKHRPTVITTDHHNNHHRSSSMIHHD 50 >At4g31420.2 68417.m04461 zinc finger (C2H2 type) family protein contains Pfam profile: PF00096 zinc finger, C2H2 type Length = 405 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +2 Query: 197 QSLYTEEKHRRHDRPAVYTTAQHRSHKYRSSRGHHEH 307 QS +EK++ ++ P +YT A + YRSS+ H +H Sbjct: 51 QSALAQEKNKSNEAPMLYTCA-ICAKGYRSSKAHEQH 86 >At4g31420.1 68417.m04460 zinc finger (C2H2 type) family protein contains Pfam profile: PF00096 zinc finger, C2H2 type Length = 404 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +2 Query: 197 QSLYTEEKHRRHDRPAVYTTAQHRSHKYRSSRGHHEH 307 QS +EK++ ++ P +YT A + YRSS+ H +H Sbjct: 51 QSALAQEKNKSNEAPMLYTCA-ICAKGYRSSKAHEQH 86 >At2g42140.1 68415.m05216 VQ motif-containing protein contains PF05678: VQ motif Length = 172 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +2 Query: 170 DGERMRRVVQSLYTEEKHRRHDRPAVYTTAQHRSHKYRSSRGHHEHPD 313 D R +VQ+L ++ H HD P + R+ + R S HHE D Sbjct: 47 DVANFREIVQNLTGKQDHHHHDLP--HQKGLKRNPRSRRSHDHHEVHD 92 >At2g38660.1 68415.m04748 tetrahydrofolate dehydrogenase/cyclohydrolase, putative similar to SP|P09440 C-1-tetrahydrofolate synthase, mitochondrial precursor (C1-THF synthase) [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9); Formyltetrahydrofolate synthetase (EC 6.3.4.3) {Saccharomyces cerevisiae}; contains Pfam profiles PF02882: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain, PF00763: Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain Length = 352 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +3 Query: 174 VSGCEESSSHCILKR-NTDATIGLQFTPLHNIDRINTEVHGVIMNIPIPFPLPES 335 + CEE+ +L D T G + L + +T +HG+++ +P+P L ES Sbjct: 115 IKACEETGIKSVLAELPEDCTEGQIISVLRKFNE-DTSIHGILVQLPLPQHLNES 168 >At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 135 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 Query: 242 AVYTTAQHRSHKYRSSRGHHEHPDTVPP 325 A++ HR K+R R HH+HP PP Sbjct: 64 AIHEKHHHRRKKWRQRR-HHKHPPPPPP 90 >At5g47430.1 68418.m05844 expressed protein Length = 879 Score = 29.1 bits (62), Expect = 3.7 Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 1/68 (1%) Frame = +2 Query: 164 QRDGERMRRVVQSLYTEEKHRRHDRPAVYTTAQHRSHKYRSSRG-HHEHPDTVPPAGV*R 340 QRD ER R Q + E R DR + HR H+ + R HH + PP+ Sbjct: 704 QRDRERSRH--QDV-DREHDRTRDRRDEDRSRDHRHHRGETERSQHHHRKRSEPPSSEPP 760 Query: 341 VQGQRADL 364 V +A++ Sbjct: 761 VPATKAEI 768 >At4g33120.1 68417.m04718 coclaurine N-methyltransferase, putative similar to coclaurine N-methyltransferase [Coptis japonica] GI:16754879 Length = 355 Score = 29.1 bits (62), Expect = 3.7 Identities = 23/84 (27%), Positives = 34/84 (40%), Gaps = 3/84 (3%) Frame = -2 Query: 458 ELPLYFHCHLRIRLQDRQCCFIIRQGSLLEGAGQPVV---LARVRLRQGERYRDVHDDPV 288 ELP F H R CC+ S LE AG+ ++ R ++ G+ D+ Sbjct: 82 ELPTAFFEHALGRNIKYSCCYYSNDSSSLEEAGEAMLALSCERAKVEDGQSVLDIGCGWG 141 Query: 287 NFCIYAIDVVQWCKLQADRGVCVS 216 + +Y CKL G+C S Sbjct: 142 SLTLYIARKYSKCKL---TGICNS 162 >At2g04620.1 68415.m00470 cation efflux family protein potential member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, see PMID:11500563 Length = 798 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +2 Query: 206 YTEEKHRRHDRPAVYTTAQHRSHKYRSSRGHHEHPDT 316 + EE H H + H+SH +++ HH+H D+ Sbjct: 541 FHEEHHHAHGGSGCTHSHSHQSHSHKNEE-HHQHSDS 576 >At1g04530.1 68414.m00445 expressed protein Length = 310 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 688 PLILRNYTSFTECVGDLTGS 747 PL+L+NY F E GDL+G+ Sbjct: 136 PLLLKNYAKFLEYKGDLSGA 155 >At1g22800.1 68414.m02848 expressed protein similar to Biotin synthesis protein bioC. {Serratia marcescens} (SP:P36571); ESTs gb|Z34075, gb|Z34835 and gb|AA404888 come from this gene Length = 355 Score = 28.7 bits (61), Expect = 5.0 Identities = 22/67 (32%), Positives = 32/67 (47%) Frame = +3 Query: 57 LILSTKMLFFITAAVLLASAEAKFFKDCGSKLATVHNVTVSGCEESSSHCILKRNTDATI 236 L+ K+L TA A ++ F + G+ AT + ++G E SSH KR AT+ Sbjct: 283 LLERNKILNRETAVATAAIYDSMFATEDGTIPATFQVIYMTGWREHSSHPQAKRRGSATV 342 Query: 237 GLQFTPL 257 FT L Sbjct: 343 --SFTDL 347 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 218 KHRRHDRPAVYTTAQHRSHKYRSSRGHHEHPDTV 319 + R+H++ + +H H++RSSR HE V Sbjct: 740 RSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDV 773 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 218 KHRRHDRPAVYTTAQHRSHKYRSSRGHHEHPDTV 319 + R+H++ + +H H++RSSR HE V Sbjct: 740 RSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDV 773 >At3g45210.1 68416.m04879 expressed protein contains Pfam profile PF04520: Protein of unknown function, DUF584 Length = 148 Score = 27.9 bits (59), Expect = 8.7 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -3 Query: 187 SHPLTVTLWTVASLDPQSLKNLASALAKSTAAVMKNN 77 S P TVT TVAS P +++N + L K ++N+ Sbjct: 60 SSPATVTTTTVASSLPMNVQNWSKILGKENRKSIEND 96 >At2g46710.1 68415.m05828 rac GTPase activating protein, putative similar to rac GTPase activating protein 2 [Lotus japonicus] GI:3695061; contains Pfam profiles PF00620: RhoGAP domain, PF00786: P21-Rho-binding domain Length = 455 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 358 SPLSLHASDSGRGNGIGMFMMTP*TSVFMRSML 260 +PLS HAS SG G+G G + + +R L Sbjct: 54 TPLSSHASRSGNGSGSGQLTVVDLLAAVLRKSL 86 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,768,945 Number of Sequences: 28952 Number of extensions: 340778 Number of successful extensions: 931 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 927 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1892353600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -