BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0910 (745 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P57413 Cluster: Ribosomal RNA small subunit methyltrans... 36 0.80 >UniRef50_P57413 Cluster: Ribosomal RNA small subunit methyltransferase C (EC 2.1.1.52) (rRNA (guanine-N(2)-)-methyltransferase); n=3; Buchnera aphidicola|Rep: Ribosomal RNA small subunit methyltransferase C (EC 2.1.1.52) (rRNA (guanine-N(2)-)-methyltransferase) - Buchnera aphidicola subsp. Acyrthosiphon pisum (Acyrthosiphon pisumsymbiotic bacterium) Length = 338 Score = 36.3 bits (80), Expect = 0.80 Identities = 12/31 (38%), Positives = 24/31 (77%) Frame = -1 Query: 268 NNIKGFKFTKYSLDRNRFNGAVIFLNLHTNL 176 NN+ K ++Y+L+ N+FNG +++ NL++N+ Sbjct: 229 NNMYALKCSQYTLNSNKFNGKIVYSNLYSNV 259 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 655,000,987 Number of Sequences: 1657284 Number of extensions: 12548667 Number of successful extensions: 26002 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 25217 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25994 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 60911752460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -