BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0909 (721 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0881 + 12115757-12115915,12116008-12116135,12117630-121177... 32 0.40 10_01_0133 + 1621574-1625779 28 8.6 >03_02_0881 + 12115757-12115915,12116008-12116135,12117630-12117780, 12117888-12118091,12118583-12119007,12119100-12119292, 12119439-12119534,12119670-12119825,12119927-12120091 Length = 558 Score = 32.3 bits (70), Expect = 0.40 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 Query: 520 KHNIRPYACVSVIGVGKLTLTIKGKLSGYFFKNL 621 ++ IR YAC + G +T G SGYF NL Sbjct: 347 RNGIRTYACSETVKFGHVTFFWNGNRSGYFHPNL 380 >10_01_0133 + 1621574-1625779 Length = 1401 Score = 27.9 bits (59), Expect = 8.6 Identities = 17/45 (37%), Positives = 28/45 (62%), Gaps = 4/45 (8%) Frame = -1 Query: 520 SNEYRFYTPPLLKHLTF--SCGPNSIVFRSFTQNFR--IRSLKQK 398 SN YTPP ++HL+ SC +++ + QNF+ IR+LK++ Sbjct: 564 SNPRFAYTPPSIRHLSIRTSCTSDTVGLDHY-QNFKEEIRNLKEQ 607 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,412,336 Number of Sequences: 37544 Number of extensions: 274647 Number of successful extensions: 432 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 427 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 432 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1874582652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -