BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0909 (721 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52207| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_35748| Best HMM Match : Ank (HMM E-Value=0.0015) 28 8.8 >SB_52207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 27.9 bits (59), Expect = 8.8 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Frame = -1 Query: 583 WSMLVSLHQ*QRHKRKVVYYV--SNEYRF 503 WS+L +LH +RH ++V Y +NE F Sbjct: 2 WSVLAALHPVERHSKRVQQYTPYANELNF 30 >SB_35748| Best HMM Match : Ank (HMM E-Value=0.0015) Length = 129 Score = 27.9 bits (59), Expect = 8.8 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = -1 Query: 451 IVFRSFTQNFRIRSLKQKYIQKYTLEILLCYNLQLTSE 338 ++ R+ Q F R + ++YI++Y L +NL +T++ Sbjct: 51 VLIRNGAQQFYCRKMHEEYIKRYRLSRKRAWNLFVTTQ 88 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,591,363 Number of Sequences: 59808 Number of extensions: 340431 Number of successful extensions: 825 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 782 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 825 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1913853903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -