BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0909 (721 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30070.1 68417.m04277 plant defensin-fusion protein, putative... 29 4.1 At3g08590.2 68416.m00998 2,3-biphosphoglycerate-independent phos... 28 7.2 At3g08590.1 68416.m00997 2,3-biphosphoglycerate-independent phos... 28 7.2 >At4g30070.1 68417.m04277 plant defensin-fusion protein, putative contains a C-terminal plant defensin domain, personal communication, Bart Thomma (Bart.Thomma@agr.kuleuven.ac.be) Length = 129 Score = 28.7 bits (61), Expect = 4.1 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 129 CGVRLFGGNPRCQVV*IISFCQCSY 203 C + GG+ C + SFCQC Y Sbjct: 103 CAQKYIGGHGFCNTLGTFSFCQCEY 127 >At3g08590.2 68416.m00998 2,3-biphosphoglycerate-independent phosphoglycerate mutase, putative / phosphoglyceromutase, putative strong similarity to SP|Q42908 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC 5.4.2.1) (Phosphoglyceromutase) {Mesembryanthemum crystallinum}; contains Pfam profile PF01676: Metalloenzyme superfamily Length = 560 Score = 27.9 bits (59), Expect = 7.2 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +1 Query: 523 HN-IRPYACVSVIGVGKLTLTIKGKLSGYFFKNL 621 HN +R +AC + G +T G SGYF + L Sbjct: 349 HNGVRTFACSETVKFGHVTFFWNGNRSGYFNEKL 382 >At3g08590.1 68416.m00997 2,3-biphosphoglycerate-independent phosphoglycerate mutase, putative / phosphoglyceromutase, putative strong similarity to SP|Q42908 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC 5.4.2.1) (Phosphoglyceromutase) {Mesembryanthemum crystallinum}; contains Pfam profile PF01676: Metalloenzyme superfamily Length = 560 Score = 27.9 bits (59), Expect = 7.2 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +1 Query: 523 HN-IRPYACVSVIGVGKLTLTIKGKLSGYFFKNL 621 HN +R +AC + G +T G SGYF + L Sbjct: 349 HNGVRTFACSETVKFGHVTFFWNGNRSGYFNEKL 382 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,117,718 Number of Sequences: 28952 Number of extensions: 246400 Number of successful extensions: 382 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 382 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1565336320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -