BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0908 (400 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|c... 26 2.5 SPAC21E11.08 |lcb2|SPAC2C4.02|serine palmitoyltransferase |Schiz... 25 4.3 SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces... 24 7.6 >SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 796 Score = 25.8 bits (54), Expect = 2.5 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 6/46 (13%) Frame = +3 Query: 177 TTASFLAG--LPEPLFLFT----YLIKIPLLFYYGLCTYIIYLHMY 296 T SF G LP+P+F+ Y I PL+ +GL +II +Y Sbjct: 625 TPDSFSVGIFLPQPMFIMLICLCYSIISPLILVFGLIYFIIGFLVY 670 Score = 25.0 bits (52), Expect = 4.3 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +3 Query: 153 GVLTINKITTASFLAGLPEPLFLFTYLIKIPLLFYYGLCTYIIYL 287 G N I S + GLP+P F YL +LF Y + +++Y+ Sbjct: 173 GPSLFNPIGNLSDIPGLPQPGDGFLYLY---VLFTYFISIFLLYV 214 >SPAC21E11.08 |lcb2|SPAC2C4.02|serine palmitoyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 603 Score = 25.0 bits (52), Expect = 4.3 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 Query: 252 FYYGLCTYIIYLHMYTIQHLKYF 320 +YY + TY+ YL + I H++ F Sbjct: 90 YYYVVATYLTYLVLIIIGHVRDF 112 >SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 3699 Score = 24.2 bits (50), Expect = 7.6 Identities = 9/37 (24%), Positives = 22/37 (59%) Frame = +3 Query: 171 KITTASFLAGLPEPLFLFTYLIKIPLLFYYGLCTYII 281 ++ + + G+ +PL ++ ++ K P LF + C++ I Sbjct: 1918 RLVISEDVQGISQPLTVYQFICKAPDLF-FSCCSHFI 1953 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,575,058 Number of Sequences: 5004 Number of extensions: 29637 Number of successful extensions: 66 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 134126124 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -