BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0907 (774 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 167 7e-44 AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 150 1e-38 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 150 1e-38 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 22 6.3 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 167 bits (407), Expect = 7e-44 Identities = 81/112 (72%), Positives = 93/112 (83%) Frame = +2 Query: 41 DNRAVQKLRREVEKAKRALSSSHQVKIEIESFFEGDDFSETLTRAKFEELNMDLFRSTLK 220 D +A+QKLRREVEKAKR LSS H+ + IE+ DFSETLTRAKFEELN D F TLK Sbjct: 83 DKKALQKLRREVEKAKRDLSSVHKTTLTIENLLADYDFSETLTRAKFEELNNDQFLKTLK 142 Query: 221 PVQKVLEDADMNKKDVDEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDE 376 PV+KVLEDADM K +DEIVLVGGSTRIPK+QQL+K+FF+GKE +RGINPDE Sbjct: 143 PVKKVLEDADMTKDQIDEIVLVGGSTRIPKIQQLIKDFFDGKELNRGINPDE 194 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 150 bits (363), Expect = 1e-38 Identities = 69/110 (62%), Positives = 88/110 (80%) Frame = +2 Query: 47 RAVQKLRREVEKAKRALSSSHQVKIEIESFFEGDDFSETLTRAKFEELNMDLFRSTLKPV 226 RA+++LR + E+AKR LSS+ Q IEI+S F+G D+S T+TRA+FE++NMD F+ + PV Sbjct: 86 RALRRLRTQCERAKRTLSSATQASIEIDSLFDGIDYSTTITRARFEDINMDYFKKCIDPV 145 Query: 227 QKVLEDADMNKKDVDEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDE 376 KVL+DA + K V EIVLVGGSTRIPKVQQL+ E+FNGKEP R INPDE Sbjct: 146 DKVLQDAKIGKSAVHEIVLVGGSTRIPKVQQLITEYFNGKEPCRSINPDE 195 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 150 bits (363), Expect = 1e-38 Identities = 69/110 (62%), Positives = 88/110 (80%) Frame = +2 Query: 47 RAVQKLRREVEKAKRALSSSHQVKIEIESFFEGDDFSETLTRAKFEELNMDLFRSTLKPV 226 RA+++LR + E+AKR LSS+ Q IEI+S F+G D+S T+TRA+FE++NMD F+ + PV Sbjct: 86 RALRRLRTQCERAKRTLSSATQASIEIDSLFDGIDYSTTITRARFEDINMDYFKKCIDPV 145 Query: 227 QKVLEDADMNKKDVDEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDE 376 KVL+DA + K V EIVLVGGSTRIPKVQQL+ E+FNGKEP R INPDE Sbjct: 146 DKVLQDAKIGKSAVHEIVLVGGSTRIPKVQQLITEYFNGKEPCRSINPDE 195 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -3 Query: 511 NEFGHHSTDSFNTHGQRVDI 452 +E G+H+ +S + G+ VDI Sbjct: 41 DEEGYHTPESLHYEGRAVDI 60 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,431 Number of Sequences: 336 Number of extensions: 3611 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20857569 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -