BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0906 (720 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 24 1.7 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 2.2 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 23 2.9 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 3.8 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 23 3.8 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 236 QPIVVDWVTRSSSRQR 283 QPI W+TRS +R++ Sbjct: 81 QPISYKWITRSGTREQ 96 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.4 bits (48), Expect = 2.2 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +1 Query: 187 IISLPPQIRAVDLLHKAAYRRGLGNSLFISPKRIND--ISSESLQLFAS 327 +I L Q+ + +H ++ R L +S+F +R+N +S L LF S Sbjct: 294 MICLNGQVLKRESIHNSSNARFLMDSMFDFAERVNSLRLSDAELGLFCS 342 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +1 Query: 640 GPFAAAGFNVSYSDNGLFGVVLS 708 G + G N + + G+FG+ LS Sbjct: 242 GDYNIGGLNFQWGEEGIFGMSLS 264 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 22.6 bits (46), Expect = 3.8 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +2 Query: 623 RPSATSAHSQRPDSTLATATMDYSALFY 706 RP + S Q +S T+T+ S +FY Sbjct: 553 RPGSNSIERQSSESPFTTSTIMPSDIFY 580 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 22.6 bits (46), Expect = 3.8 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +2 Query: 623 RPSATSAHSQRPDSTLATATMDYSALFY 706 RP + S Q +S T+T+ S +FY Sbjct: 553 RPGSNSIERQSSESPFTTSTIMPSDIFY 580 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.314 0.132 0.376 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,315 Number of Sequences: 438 Number of extensions: 3728 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -