BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0905 (508 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 27 0.48 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 26 0.64 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 25 1.1 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 25 1.9 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 24 2.6 AJ618920-1|CAF01999.1| 204|Anopheles gambiae putative odorant-b... 24 3.4 EF382662-1|ABN54495.1| 178|Anopheles gambiae CPF family cuticle... 23 4.5 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 23 4.5 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 4.5 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 5.9 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 7.9 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 26.6 bits (56), Expect = 0.48 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 299 RSPGTALTTGHPPATH 346 R PG A TG PP TH Sbjct: 908 RGPGAAAATGPPPPTH 923 Score = 23.0 bits (47), Expect = 5.9 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 164 SGGGKACHDEGGCATGSGKPVE 99 SGGG+A G G+G P E Sbjct: 1133 SGGGQANQAAAGSDGGAGSPAE 1154 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 26.2 bits (55), Expect = 0.64 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -3 Query: 230 GTTLGGESLRASTSVGACCPTYSGGGKACHDEGGCATGSGKPVEPRCASAGS 75 GTT GG L C GGG GG + S K P GS Sbjct: 179 GTTNGGGELTTGGGTNGCTKA-GGGGGGTGTGGGLVSSSEKNYNPVRKKLGS 229 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 25.4 bits (53), Expect = 1.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 99 FDGFSAARRTAPFIVACFAPP 161 F+GF A F +C+APP Sbjct: 69 FEGFCIAEVNGVFFCSCYAPP 89 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 24.6 bits (51), Expect = 1.9 Identities = 20/90 (22%), Positives = 32/90 (35%) Frame = -3 Query: 305 GTDPWLNNKGTK*MMANLQKTLPQEGTTLGGESLRASTSVGACCPTYSGGGKACHDEGGC 126 G P + G++ ++ T P +L S +S++ +GGG GG Sbjct: 767 GPPPDGSGSGSRCSKPSVTSTTPPTPASLSSSSSSSSSASSTSLCGGNGGGGGAGASGGG 826 Query: 125 ATGSGKPVEPRCASAGSTRSALVSDCEAAG 36 +G P + A G L AG Sbjct: 827 FLITGDPSDTIGAGGGGAGGPLRGSSGGAG 856 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 24.2 bits (50), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 82 ALAHLGSTGFPLPVAQPPSSWHALPPPE 165 AL L +TG P+A+P ++ A P PE Sbjct: 90 ALPKLSATGASKPIAEPKAA-SATPAPE 116 >AJ618920-1|CAF01999.1| 204|Anopheles gambiae putative odorant-binding protein OBPjj4 protein. Length = 204 Score = 23.8 bits (49), Expect = 3.4 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -3 Query: 131 GCATGSGKPVEPRCASAGSTRSALVSDCEAAGP 33 GC G+ V+ CA ++ C+AA P Sbjct: 30 GCHNGTSITVDECCAIPMLANKTVIEKCKAAHP 62 >EF382662-1|ABN54495.1| 178|Anopheles gambiae CPF family cuticle protein protein. Length = 178 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/42 (23%), Positives = 18/42 (42%) Frame = +1 Query: 61 SAERVEPALAHLGSTGFPLPVAQPPSSWHALPPPEYVGQHAP 186 +A PA+ + + + P P++ H P + HAP Sbjct: 93 AAHYAAPAVHYPAAAHYAAPAVHYPAAAHYAAPAVHYAAHAP 134 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/28 (32%), Positives = 18/28 (64%), Gaps = 3/28 (10%) Frame = +2 Query: 206 GILH---LEWYPPGVMFFVSLPSFISFL 280 G+LH +E P G+++++++PS L Sbjct: 678 GVLHPQEMEALPAGLVYYITIPSMYMLL 705 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.4 bits (48), Expect = 4.5 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = -3 Query: 236 QEGTTLGGESLRASTSVGACCPTYSGGGKACHDEGGCATGS 114 +EG T RAS C P GGG+ C G C G+ Sbjct: 619 REGWTGPACDCRASNET--CMPP--GGGELCSGHGTCECGT 655 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.0 bits (47), Expect = 5.9 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +1 Query: 118 PVAQPPSSWHALPPPEYVGQHAPTEVEARRDSPPRVVP 231 P + P + P+Y + PT + + PRVVP Sbjct: 1074 PDYELPPEHSDVTTPDYDQRSTPTPQRSHTQAGPRVVP 1111 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 22.6 bits (46), Expect = 7.9 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 31 FGPAASQSLTSAERVEPALAHLGSTGFPLPV 123 +GPAAS ++ S P L + +T PV Sbjct: 1083 YGPAASDAIASIPAAVPLLLEVTTTVDHTPV 1113 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 621,057 Number of Sequences: 2352 Number of extensions: 14865 Number of successful extensions: 39 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45668772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -