BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0904 (498 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0009 - 12132781-12133272 28 3.6 01_01_0484 - 3558941-3559303,3559439-3559560,3560596-3560743,356... 27 6.3 03_06_0498 - 34341441-34341575,34341808-34341945,34342019-343421... 27 8.4 >11_04_0009 - 12132781-12133272 Length = 163 Score = 28.3 bits (60), Expect = 3.6 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 Query: 317 RSSTWAREQRWSCSKPAPERRRRIGSLR 400 R W RE+R S + P +RRR+G R Sbjct: 108 RGEAWRRERRDSKIESRPSQRRRVGGRR 135 >01_01_0484 - 3558941-3559303,3559439-3559560,3560596-3560743, 3560853-3561491,3562154-3562450,3562553-3563407, 3564363-3564545,3565041-3565118,3565762-3565974, 3566075-3566238,3566357-3566445,3566761-3566891, 3566980-3567148,3567255-3567327,3567525-3567606, 3567677-3567808,3568743-3568818,3568965-3569065, 3569446-3569636,3569738-3569912,3570604-3570854, 3571327-3571603,3572184-3572267,3572496-3573206 Length = 1867 Score = 27.5 bits (58), Expect = 6.3 Identities = 17/52 (32%), Positives = 28/52 (53%) Frame = -2 Query: 482 SLSHQVISTAPLVS*RPPLNLHKLTMNFAKILSFVFALVLALSMTSAAPEPR 327 +LS + S P V+ ++ +L + A +LS AL L ++ SA+P PR Sbjct: 62 ALSSLLASPHPAVAAHAAASVARLAASRADLLSPELALPLLIAPLSASPSPR 113 >03_06_0498 - 34341441-34341575,34341808-34341945,34342019-34342117, 34342320-34342400,34342548-34342610,34342717-34342764, 34343033-34343410,34345413-34345537,34345635-34345701, 34345797-34345856,34346495-34346621,34346670-34346986 Length = 545 Score = 27.1 bits (57), Expect = 8.4 Identities = 12/44 (27%), Positives = 24/44 (54%) Frame = -2 Query: 374 ALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVL 243 A+++A+ M + P PRW + + ++ ++ D KA A+ L Sbjct: 259 AVIMAIGMWNLPPSPRWLLLRAVQGKA-SVEDNKKKAIQALRSL 301 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,909,026 Number of Sequences: 37544 Number of extensions: 174325 Number of successful extensions: 397 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 395 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 397 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -