BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0904 (498 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g59520.3 68414.m06686 expressed protein (CW7) 27 5.3 At1g59520.1 68414.m06685 expressed protein (CW7) 27 5.3 At1g73710.1 68414.m08535 pentatricopeptide (PPR) repeat-containi... 27 9.3 >At1g59520.3 68414.m06686 expressed protein (CW7) Length = 388 Score = 27.5 bits (58), Expect = 5.3 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 253 IAGPALTMPSRMFLPIFSIFLKIFHLGSGAALVMLKASTRAKTKDRIF 396 + GP M S+ + + SIF K + S AA + A+T + +D +F Sbjct: 310 VLGPVSPMSSKKSIDLGSIFRKAASVASVAAKHAIAAATASYDEDEMF 357 >At1g59520.1 68414.m06685 expressed protein (CW7) Length = 388 Score = 27.5 bits (58), Expect = 5.3 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 253 IAGPALTMPSRMFLPIFSIFLKIFHLGSGAALVMLKASTRAKTKDRIF 396 + GP M S+ + + SIF K + S AA + A+T + +D +F Sbjct: 310 VLGPVSPMSSKKSIDLGSIFRKAASVASVAAKHAIAAATASYDEDEMF 357 >At1g73710.1 68414.m08535 pentatricopeptide (PPR) repeat-containing protein low similarity to fertility restorer [Petunia x hybrida] GI:22128587, post-transcriptional control of chloroplast gene expression CRP1 [Zea mays] GI:3289002; contains Pfam profile PF01535: PPR repeat Length = 991 Score = 26.6 bits (56), Expect = 9.3 Identities = 16/49 (32%), Positives = 30/49 (61%), Gaps = 2/49 (4%) Frame = +2 Query: 353 CSKPAP-ERRRRIGSLRNSL*VYVNSKADVKTQ-AALY*SLDERERRLV 493 CSKP P R+R+ G + S+ ++S D++T A+L +L +E+ ++ Sbjct: 70 CSKPNPSSRKRKYGGVIPSILRSLDSSTDIETTLASLCLNLSPKEQTVL 118 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,015,949 Number of Sequences: 28952 Number of extensions: 136404 Number of successful extensions: 317 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 317 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -