BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0903 (772 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q86QT5 Cluster: Putative uncharacterized protein; n=1; ... 72 2e-11 UniRef50_Q86QT4 Cluster: Putative uncharacterized protein; n=1; ... 45 0.002 >UniRef50_Q86QT5 Cluster: Putative uncharacterized protein; n=1; Bombyx mori|Rep: Putative uncharacterized protein - Bombyx mori (Silk moth) Length = 77 Score = 71.7 bits (168), Expect = 2e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +3 Query: 429 LADPADFVVPQSINKRPKLLYKINLTQTKGIRPTGGTHQRK 551 LADPADFVVPQSINKRPK LYKINL QTKGIR TG T + K Sbjct: 22 LADPADFVVPQSINKRPKHLYKINLKQTKGIRQTGDTSKEK 62 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 533 GDTSKEKQNCNFYLIPSIFI 592 GDTSKEKQNC FYLIP IFI Sbjct: 56 GDTSKEKQNCYFYLIPRIFI 75 >UniRef50_Q86QT4 Cluster: Putative uncharacterized protein; n=1; Bombyx mori|Rep: Putative uncharacterized protein - Bombyx mori (Silk moth) Length = 47 Score = 45.2 bits (102), Expect = 0.002 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = -2 Query: 681 LKFENGWTDLANFGLKLFVEVQKRFK 604 LK ENGWTDLANFGL+L VEVQ+ K Sbjct: 20 LKLENGWTDLANFGLELPVEVQRGLK 45 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 726,727,065 Number of Sequences: 1657284 Number of extensions: 14483054 Number of successful extensions: 31104 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 29699 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31087 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 64615845515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -