BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0903 (772 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80952-3|AAB38093.1| 279|Caenorhabditis elegans Hypothetical pr... 32 0.52 U52003-4|ABB51171.1| 771|Caenorhabditis elegans P granule abnor... 29 4.8 AL021487-12|CAA16358.2| 324|Caenorhabditis elegans Hypothetical... 29 4.8 M77697-8|ABB88245.1| 308|Caenorhabditis elegans Hypothetical pr... 28 6.4 AF022973-9|AAC25802.2| 1373|Caenorhabditis elegans Hypothetical ... 28 6.4 >U80952-3|AAB38093.1| 279|Caenorhabditis elegans Hypothetical protein F54H5.3 protein. Length = 279 Score = 31.9 bits (69), Expect = 0.52 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = +3 Query: 366 VQKTVIETWKYYPNIENFIK*LADPADFVVPQSINKRPKLLYKINLTQTKGIRP 527 +Q T+I+ KY N + ++ + P DF + I K+P L T+ K +RP Sbjct: 85 IQITLIDGTKYQSNHQFIVQAMPSPGDFADRKFIWKQPNFLGIFTNTRVKTMRP 138 >U52003-4|ABB51171.1| 771|Caenorhabditis elegans P granule abnormality protein 1,isoform b protein. Length = 771 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 539 TSKEKQNCNFYLIPSIFIVFYFLNLFW 619 T +E+ +CNF L+P F VF LFW Sbjct: 13 TRRERGSCNFDLVPIFFSVFL---LFW 36 >AL021487-12|CAA16358.2| 324|Caenorhabditis elegans Hypothetical protein Y45F10B.6 protein. Length = 324 Score = 28.7 bits (61), Expect = 4.8 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 569 YLIPSIFIVFYFLNLFWTS 625 YL+P++FI+F +FW S Sbjct: 36 YLVPTVFIIFKVFKVFWGS 54 >M77697-8|ABB88245.1| 308|Caenorhabditis elegans Hypothetical protein B0303.16 protein. Length = 308 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +2 Query: 524 SDGGDTSKEKQNCNFYLIPSIFIVFYFLNLFWTSTNNL 637 ++ GD SK ++ +IP I I+ +FL + T +++ Sbjct: 89 AESGDESKSDKSLMTQIIPKISIILFFLAFYLTHASSM 126 >AF022973-9|AAC25802.2| 1373|Caenorhabditis elegans Hypothetical protein F25G6.9 protein. Length = 1373 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +2 Query: 620 TSTN-NLRPKLAKSVQPFSNFSETNEQQFIYIFIHLYRFPKF 742 +STN +L+ ++ K + F + N QF+ FI LY+ P F Sbjct: 339 SSTNPSLQERICKLIALFVKKAPENADQFVLYFITLYQKPFF 380 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,352,758 Number of Sequences: 27780 Number of extensions: 367956 Number of successful extensions: 895 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 862 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 895 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1851132448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -