BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0902 (693 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 25 0.59 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.4 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 2.4 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 2.4 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 2.4 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 2.4 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 2.4 AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax pr... 23 2.4 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 2.4 DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory pro... 21 9.6 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 9.6 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 21 9.6 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 21 9.6 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 9.6 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 21 9.6 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 25.0 bits (52), Expect = 0.59 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +3 Query: 9 LRTGGWYVENGALQIHNSANTAKYRIIPEG 98 +R W +G+L H + +KY ++P G Sbjct: 154 VRVEAWVGSDGSLYNHTANYDSKYLVLPSG 183 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 2.4 Identities = 17/53 (32%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = -3 Query: 481 PYSIHSRYSTHPSQHSHICCMQSPKKRIFFIA*LGGRAHNPPGV-KWLLEPID 326 P S+HS P QHS + PK + A GV K+L ID Sbjct: 1796 PPSVHSSTVVPPPQHSTTQSLVDPKSEFKVVCYFTNWAWYRQGVGKYLPSDID 1848 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 2.4 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = -3 Query: 517 HFQTSSNILL--LIPYSIHSRYSTHPSQHSHI 428 H S NI+ + PY ++ HPSQ +H+ Sbjct: 279 HKMASMNIVPYHMSPYGHPYQFDLHPSQFAHL 310 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 2.4 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = -3 Query: 517 HFQTSSNILL--LIPYSIHSRYSTHPSQHSHI 428 H S NI+ + PY ++ HPSQ +H+ Sbjct: 279 HKMASMNIVPYHMSPYGHPYQFDLHPSQFAHL 310 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 2.4 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = -3 Query: 517 HFQTSSNILL--LIPYSIHSRYSTHPSQHSHI 428 H S NI+ + PY ++ HPSQ +H+ Sbjct: 279 HKMASMNIVPYHMSPYGHPYQFDLHPSQFAHL 310 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 23.0 bits (47), Expect = 2.4 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = -3 Query: 517 HFQTSSNILL--LIPYSIHSRYSTHPSQHSHI 428 H S NI+ + PY ++ HPSQ +H+ Sbjct: 235 HKMASMNIVPYHMSPYGHPYQFDLHPSQFAHL 266 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 23.0 bits (47), Expect = 2.4 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = -3 Query: 517 HFQTSSNILL--LIPYSIHSRYSTHPSQHSHI 428 H S NI+ + PY ++ HPSQ +H+ Sbjct: 279 HKMASMNIVPYHMSPYGHPYQFDLHPSQFAHL 310 >AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax protein. Length = 100 Score = 23.0 bits (47), Expect = 2.4 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = -3 Query: 517 HFQTSSNILL--LIPYSIHSRYSTHPSQHSHI 428 H S NI+ + PY ++ HPSQ +H+ Sbjct: 67 HKMASMNIVPYHMSPYGHPYQFDLHPSQFAHL 98 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 23.0 bits (47), Expect = 2.4 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = -3 Query: 517 HFQTSSNILL--LIPYSIHSRYSTHPSQHSHI 428 H S NI+ + PY ++ HPSQ +H+ Sbjct: 279 HKMASMNIVPYHMSPYGHPYQFDLHPSQFAHL 310 >DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory protein 4 protein. Length = 133 Score = 21.0 bits (42), Expect = 9.6 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = +2 Query: 629 YRGSGRLKKKWMDCMKDDICK 691 Y G KK++ + KD++ K Sbjct: 110 YDPDGTYKKRYFESQKDEVSK 130 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.0 bits (42), Expect = 9.6 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +2 Query: 566 HVMRRNENEVGKRVLTMNVEGYRGSGRLKKKWM 664 H ++ ++ + + V NV G G+L +WM Sbjct: 629 HTVKVSDFGLSRDVYQDNVYCKNGGGKLPVRWM 661 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 346 WLLEPIDIYNVNAPPTLRYK 287 WL P + N P +LR+K Sbjct: 7 WLTPPHSLGNTVTPVSLRFK 26 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 170 PLVSPHG*VPPP 205 P V PH VPPP Sbjct: 12 PTVLPHQEVPPP 23 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.0 bits (42), Expect = 9.6 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = +2 Query: 281 LKLISQSGWRIYVVDVYGLQ*PLNTRWVVSSSTQLSNKKNPLFRRL 418 L+++ S +Y +D + +W+ +S ++S N LFR L Sbjct: 274 LQVLDLSHNSLYELDFDTFRNTKKLQWLDTSHNRISEIPNDLFRFL 319 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 611 LTLSYQPHFHFVSSHVHT 558 L SYQ HF+ + + HT Sbjct: 37 LRTSYQHHFNSPAGNAHT 54 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,298 Number of Sequences: 336 Number of extensions: 4403 Number of successful extensions: 16 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18218375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -