BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0898 (714 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0393 - 17630097-17630367,17630483-17630709 29 3.7 05_05_0357 + 24377989-24378039,24378601-24378632,24378724-243788... 29 3.7 01_01_0363 + 2850954-2853675,2853819-2854225 29 4.8 03_02_0127 + 5777564-5779879 28 6.4 01_01_0898 + 7078900-7079079,7080269-7080301,7080480-7080653,708... 28 6.4 01_01_1096 - 8659091-8659459,8660730-8661050,8661416-8661694,866... 28 8.5 >07_03_0393 - 17630097-17630367,17630483-17630709 Length = 165 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +1 Query: 580 ASPPLAVDVQAPVSGYCPGQVIPLKIDIENKSNVH 684 + P L D +P+ C G+V+P+K+++ + H Sbjct: 105 SDPNLGADNASPLLSDCTGEVVPVKVELGPRQERH 139 >05_05_0357 + 24377989-24378039,24378601-24378632,24378724-24378818, 24379165-24379237,24379804-24379867,24380465-24380732, 24381132-24381202,24382028-24382084,24382302-24382403, 24382544-24382588,24383616-24383693,24384350-24384400, 24384475-24384556,24384883-24384956,24386093-24386144, 24386230-24386288,24386380-24386456,24386692-24386778, 24387011-24387101 Length = 502 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = -1 Query: 432 DSVSDITMFPFKR*RQDRWQCAGKIIYVFPLWYF 331 DSV+ I+ +PF R R +CA +I +F LW++ Sbjct: 149 DSVAQISFYPFIRNDIIRTKCANVLISMF-LWFY 181 >01_01_0363 + 2850954-2853675,2853819-2854225 Length = 1042 Score = 28.7 bits (61), Expect = 4.8 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +1 Query: 217 QEENAQGKTESTDTMHTGNEEYFQISYYLL--GSNTGNEIE-IPQGKHIYNFTCTL 375 Q +G+ S + E+Y +ISYY L GSN +E + +G++ + CTL Sbjct: 685 QHRKLKGRQNSQEISPVIEEQYQRISYYALSRGSNEFSEANLLGKGRYGSVYKCTL 740 >03_02_0127 + 5777564-5779879 Length = 771 Score = 28.3 bits (60), Expect = 6.4 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 6/95 (6%) Frame = +1 Query: 142 DSPKKVRGIHVKIKGEAHTELYESKQEENA-QGKTESTDTMHTGNEEYFQISYYLLGSNT 318 ++ ++ VK ++ E +EE A +G ES + + G E++ + LGS + Sbjct: 427 ENSSEIEADGVKANASMESQDAEGNEEEEAHEGLQESIEQLALG-EKHAKEPGSFLGSTS 485 Query: 319 GNEIEIPQGKHIY-NFTCTLP----PVLPSSFEGE 408 GN +E + I+ +T P P+ +S +GE Sbjct: 486 GNTVEDVKADEIFEGWTNNSPSHCQPISETSSDGE 520 >01_01_0898 + 7078900-7079079,7080269-7080301,7080480-7080653, 7080866-7083890,7084253-7084596 Length = 1251 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 543 HSIRKDVLLFLLRITTFSSGCAGSCIWLLSR 635 HS + L FLL + T + GC CI+L+ R Sbjct: 901 HSNSRHFLRFLLPVVTVAFGCMVICIFLMIR 931 >01_01_1096 - 8659091-8659459,8660730-8661050,8661416-8661694, 8661781-8661897,8662142-8662210,8663204-8663397, 8663552-8663633 Length = 476 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/45 (28%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +1 Query: 325 EIEIPQGKHIYNFTCT--LPPVLPSSFEGEHGYVRYTVKVTLDRP 453 E+ P+ ++ N C P P ++ ++GY RY V D P Sbjct: 335 ELSAPKSGYMVNSLCLPLRPGAQPCAYYAQNGYCRYGVACKYDHP 379 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,149,482 Number of Sequences: 37544 Number of extensions: 417212 Number of successful extensions: 990 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 969 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 990 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1851002996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -