Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0898
         (714 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ...    25   1.8  
AY347952-1|AAR28375.1|  634|Anopheles gambiae putative sulfakini...    24   4.1  

>AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1
            chain protein.
          Length = 1024

 Score = 25.4 bits (53), Expect = 1.8
 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 1/32 (3%)
 Frame = -3

Query: 682  GHCSYFQCLFSKVLLDL-DSNQIQEPAHPLLK 590
            GHC Y++   S  L+ L D  Q Q P    LK
Sbjct: 976  GHCHYYETQTSFWLVSLEDHQQFQRPEQQTLK 1007


>AY347952-1|AAR28375.1|  634|Anopheles gambiae putative sulfakinin
           GPCR protein.
          Length = 634

 Score = 24.2 bits (50), Expect = 4.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +1

Query: 565 CCFCCAS 585
           CCFCCAS
Sbjct: 549 CCFCCAS 555


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 793,608
Number of Sequences: 2352
Number of extensions: 18752
Number of successful extensions: 14
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 73177125
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)