BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0897 (801 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0114 - 900530-901191,901269-901338,901536-901640,901721-90... 29 4.3 >08_01_0114 - 900530-901191,901269-901338,901536-901640,901721-901831, 901912-902016,902245-902391,903273-903354,903445-903786, 903873-904177,904259-904435,904799-904852,905171-905254, 905855-905968,906048-906321,907552-907926,908003-908267, 908352-908538,908615-909052,909895-909966,910037-910630, 911471-911623,911700-911828,912326-912657,912705-912840, 913046-913491,913580-915087,915169-915431,915622-915738, 915844-916014,916743-916845,916930-916988,918360-918461, 918560-918649,918727-918877,919745-919830,919926-920102, 920915-920978,921859-922008,923132-923211,923311-923376, 924540-924747,925502-925575,925761-925848,926140-926312, 926541-926609,926698-926741,927074-927167,927290-927366, 927475-927552,927992-928085 Length = 3314 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +3 Query: 33 LIIKCRKRCYENLYEIKP*KCIRSSLSIRYVNRNQDSIIEST 158 L+ + +K+ Y L+E+ P K S S ++NRN+ S ST Sbjct: 2865 LLARKQKKVYIELFELTPIKLTFSFTSTPWLNRNESSSDPST 2906 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,053,024 Number of Sequences: 37544 Number of extensions: 273901 Number of successful extensions: 406 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 406 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2174172540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -