BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0897 (801 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 24 1.9 AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family p... 23 3.3 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 23.8 bits (49), Expect = 1.9 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = +3 Query: 111 SIRYVNRNQDSI--IESTIIKAGNVTFGQLLVNQKNELLTLYSIGSHKTLLNDI 266 +I V RN+D++ + S IK G++ Q+NE L S + L ND+ Sbjct: 338 NIDVVARNEDTLQMVVSMKIKQNVPQSGRVNNTQRNEYLLALSDRNQNVLNNDL 391 >AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family protein protein. Length = 166 Score = 23.0 bits (47), Expect = 3.3 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 430 IDKYYIFKE*KTDCGYIVIVGKRNENIHNML 522 +DK I K CG+I + KRN ++ +M+ Sbjct: 103 LDKSEISLATKQACGFIDNIDKRNLSVTSMI 133 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,412 Number of Sequences: 438 Number of extensions: 4009 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25367793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -