BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0896 (337 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 24 0.49 AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 22 1.5 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 22 1.5 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 21 2.6 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 20 6.0 AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory recept... 20 8.0 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 20 8.0 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 20 8.0 AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory recept... 20 8.0 AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 20 8.0 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 23.8 bits (49), Expect = 0.49 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 4/59 (6%) Frame = +3 Query: 168 CDRKELWNFLLKFLLSIIYIWDLLLTT--FHVLLFIGYNLRT--KFVLNPITFLNSIEF 332 C+ W F II + +TT F+ +L GYNL T F+ N + + I F Sbjct: 220 CNLTFSWYSKKVFYSKIIISGSIFMTTTSFYRILNSGYNLTTFGSFIFNANSAIEGIIF 278 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 22.2 bits (45), Expect = 1.5 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 4/46 (8%) Frame = +3 Query: 156 SINICDRKELWNFLLKFLLSI----IYIWDLLLTTFHVLLFIGYNL 281 S+ + +++ WN L K L + L+LT L+F+ YN+ Sbjct: 152 SLTLTLKRKKWNLLFKTLTHDEPRKSSLVQLILTQAIFLMFVSYNI 197 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 22.2 bits (45), Expect = 1.5 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 4/46 (8%) Frame = +3 Query: 156 SINICDRKELWNFLLKFLLSI----IYIWDLLLTTFHVLLFIGYNL 281 S+ + +++ WN L K L + L+LT L+F+ YN+ Sbjct: 78 SLTLTLKRKKWNLLFKTLTHDEPRKSSLVQLILTQAIFLMFVSYNI 123 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.4 bits (43), Expect = 2.6 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -1 Query: 205 NFKRKFHNSFLSQILMEYNMCYVL 134 NFK N ++S + + + CY + Sbjct: 128 NFKESERNDYVSLLQLVFVFCYFI 151 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 20.2 bits (40), Expect = 6.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 126 FIILVVLFLRYVFVELVRMYFLLFG 52 F +L VLF+ V + +Y LLFG Sbjct: 28 FTLLWVLFVIIVAGNVGVLYTLLFG 52 >AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory receptor candidate 56 protein. Length = 358 Score = 19.8 bits (39), Expect = 8.0 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = -1 Query: 73 DVFFTFW 53 D FFTFW Sbjct: 324 DYFFTFW 330 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 19.8 bits (39), Expect = 8.0 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = -2 Query: 261 VVRER*LIINPKYRLSKAKILRGNSIIPFC 172 ++R R +I+N S +K ++P C Sbjct: 184 IIRNRFVILNRYIEESISKYKHAELVMPLC 213 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 19.8 bits (39), Expect = 8.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +3 Query: 156 SINICDRKELWNFLLKFLL 212 SINI +LW F L L+ Sbjct: 196 SINIISLVQLWIFQLYLLI 214 >AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory receptor candidate 21 protein. Length = 386 Score = 19.8 bits (39), Expect = 8.0 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = -1 Query: 73 DVFFTFW 53 D FFTFW Sbjct: 324 DYFFTFW 330 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 19.8 bits (39), Expect = 8.0 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 195 LLKFLLSIIYIWDLLLTTFHVLLF 266 +LK S++ + LTTF V+LF Sbjct: 360 MLKISRSLLTSFGGALTTFLVILF 383 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,951 Number of Sequences: 336 Number of extensions: 1520 Number of successful extensions: 12 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 6579502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -