BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0895 (739 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY629351-1|AAV41218.1| 513|Homo sapiens DHHC domain-containing ... 35 0.35 AK172751-1|BAD18737.1| 653|Homo sapiens protein ( Homo sapiens ... 31 5.7 >AY629351-1|AAV41218.1| 513|Homo sapiens DHHC domain-containing zinc finger protein protein. Length = 513 Score = 34.7 bits (76), Expect = 0.35 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = -1 Query: 424 VIPIKSSGDSFIKLKNTLLNINFYYEDIEDADGKVHWKIFNH 299 +I + +SGD +K+ LL+I+F Y D H+ +FNH Sbjct: 206 LIKLTASGDKKSNIKSLLLDIDFRYSQFYMEDSFCHYNMFNH 247 >AK172751-1|BAD18737.1| 653|Homo sapiens protein ( Homo sapiens cDNA FLJ23912 fis, clone CAE04210, highly similar to Homo sapiens leucine rich repeat containing 4 (LRRC4). ). Length = 653 Score = 30.7 bits (66), Expect = 5.7 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = -2 Query: 675 FTSFHWAILKEVYH-PWTL-CT--WRTWWFMSLIETVSKLCSR 559 FT + + ++H PW C W WWF I T S C R Sbjct: 286 FTPLRYLVELHLHHDPWNCDCDILWLAWWFREYIPTNSTCCGR 328 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,960,085 Number of Sequences: 237096 Number of extensions: 1850903 Number of successful extensions: 3565 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3466 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3565 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8791154398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -