BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0894 (800 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 23 2.1 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 23 2.1 DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like pr... 23 2.8 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 23 2.8 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 23.4 bits (48), Expect = 2.1 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 579 TFTSSSVMKSKLKELNTRRHDLLYVPPFSNMSEYYNRS 692 T TSS++ + L E N + LY P S+ + YN S Sbjct: 15 TTTSSALNSTPLIEFNISTSNYLYTP--SSTIDLYNTS 50 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 23.4 bits (48), Expect = 2.1 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 579 TFTSSSVMKSKLKELNTRRHDLLYVPPFSNMSEYYNRS 692 T TSS++ + L E N + LY P S+ + YN S Sbjct: 15 TTTSSALNSTPLIEFNISTSNYLYTP--SSTIDLYNTS 50 >DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like protein protein. Length = 135 Score = 23.0 bits (47), Expect = 2.8 Identities = 8/21 (38%), Positives = 16/21 (76%) Frame = +2 Query: 224 SYDYLKTLASDVHVVRGDFDE 286 S + +TL SD+++++ +FDE Sbjct: 22 SEETCETLMSDINLIKEEFDE 42 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 23.0 bits (47), Expect = 2.8 Identities = 14/54 (25%), Positives = 25/54 (46%) Frame = +3 Query: 450 RLTNTRISSISILVQLLEVTALYTGILLLRLC*WTFRVRQWSPTFTSSSVMKSK 611 R N +S I ++V+ L +LY + + T + +WS F ++SK Sbjct: 55 RYMNAHLSGIQLVVRNLLDISLYLNAYHVFVTMMTLKRHKWSTLFEILLKLESK 108 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,578 Number of Sequences: 336 Number of extensions: 4973 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21791490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -