BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0894 (800 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 29 0.050 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 25 0.62 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 24 1.9 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 23 2.5 AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 23 3.3 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 23 3.3 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 29.1 bits (62), Expect = 0.050 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +3 Query: 594 SVMKSKLKELNTRRHDLL-YVPPFSNMSEYYNRSVT 698 +VM+ KLK+ R +DLL YV P + ++ R VT Sbjct: 219 NVMRMKLKQFMPRLYDLLGYVMPDRTFAPFFTRVVT 254 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 25.4 bits (53), Expect = 0.62 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -1 Query: 146 ASCCICEECEDPRGQVPT-FCMVYLYAYTVKSSCILL*IMNYVVK 15 AS C C +C++ R + T F V S C+ L MN V++ Sbjct: 323 ASSCSCLDCDEIRESLDTQFLQVCRSRRHSDSCCLCLDSMNAVIR 367 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.8 bits (49), Expect = 1.9 Identities = 10/18 (55%), Positives = 10/18 (55%), Gaps = 3/18 (16%) Frame = +1 Query: 316 HSWTVPHWTD---SWTPS 360 HSW WTD SW PS Sbjct: 92 HSWMTLMWTDSHLSWKPS 109 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 23.4 bits (48), Expect = 2.5 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = -1 Query: 449 QSDACALISGCPHPAASVSKLETLHRPKGLLGVHESVQCG 330 +SD + S P + +K+ET H L ++ ++CG Sbjct: 434 KSDMSNMQSDDGGPLSLKNKVETTHSGTSLFRINLGIECG 473 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 23.0 bits (47), Expect = 3.3 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +2 Query: 239 KTLASDVHVVRGDFDE 286 +TL S+VH+ + ++DE Sbjct: 37 ETLQSEVHITKDEYDE 52 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 23.0 bits (47), Expect = 3.3 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +2 Query: 239 KTLASDVHVVRGDFDE 286 +TL S+VH+ + ++DE Sbjct: 37 ETLQSEVHITKDEYDE 52 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 238,461 Number of Sequences: 438 Number of extensions: 5362 Number of successful extensions: 25 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25367793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -