BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0893 (793 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51926| Best HMM Match : Na_Pi_cotrans (HMM E-Value=0) 28 10.0 SB_57118| Best HMM Match : TMS_TDE (HMM E-Value=0) 28 10.0 >SB_51926| Best HMM Match : Na_Pi_cotrans (HMM E-Value=0) Length = 652 Score = 27.9 bits (59), Expect = 10.0 Identities = 10/19 (52%), Positives = 17/19 (89%) Frame = -2 Query: 198 TN*FEKILVQIDQKILSAI 142 TN F K+++QID+K+++AI Sbjct: 297 TNPFTKLIIQIDKKVITAI 315 >SB_57118| Best HMM Match : TMS_TDE (HMM E-Value=0) Length = 1457 Score = 27.9 bits (59), Expect = 10.0 Identities = 11/37 (29%), Positives = 24/37 (64%) Frame = +3 Query: 144 WPRVFSGLFGPKFSQIN*SNPELSKSEEEFQTIFLIS 254 W ++ + +FGP+FS ++ N L++ + E T++ I+ Sbjct: 420 WAKMQNKIFGPEFSGVS-RNGRLAREKAEICTVYTIN 455 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,430,516 Number of Sequences: 59808 Number of extensions: 399312 Number of successful extensions: 603 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 565 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 603 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2179815638 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -