BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0890 (808 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0415 + 3292576-3293727 30 2.5 11_01_0407 + 3090880-3092010 30 2.5 09_02_0001 - 2857651-2857923,2858089-2858283 29 4.4 >12_01_0415 + 3292576-3293727 Length = 383 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +2 Query: 206 VATPRVQIHLSSLAGVDFSQPCTMSISCWAIVSSAPC 316 +A PR H + LA ++ C + + WA+V++ PC Sbjct: 219 LAAPRA--HEAGLAAPVYAMGCVLHLVAWALVAAVPC 253 >11_01_0407 + 3090880-3092010 Length = 376 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 206 VATPRVQIHLSSLAGVDFSQPCTMSISCWAIVSSAPC 316 +A PR H L +S C + ++ WA+V++ PC Sbjct: 212 LAAPRA--HEGGLVAPVYSMGCLLHLAAWALVAAVPC 246 >09_02_0001 - 2857651-2857923,2858089-2858283 Length = 155 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = -2 Query: 636 FQIESKMSIQGQIALALMVYMAVG-SVDASQE 544 F I++K + G + +ALM+ AVG SVD QE Sbjct: 59 FAIKNKQQVAGPVLVALMMASAVGSSVDFGQE 90 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,350,645 Number of Sequences: 37544 Number of extensions: 438267 Number of successful extensions: 982 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 957 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 982 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2197677108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -