BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0888 (589 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF519512-1|ABP73575.1| 250|Anopheles gambiae APL2 protein. 26 0.79 DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosylt... 24 4.2 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 23 5.5 >EF519512-1|ABP73575.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 26.2 bits (55), Expect = 0.79 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = -1 Query: 478 LQQIG*RLLSDPVFVVVFELISFNKSHSKLMNTIDTPDITQHENLSNYDVI 326 LQQ G L+ D +F L + N SH N + T ++ Q E ++D+I Sbjct: 96 LQQNGLGLIDDRLFQGCHSLTALNVSH----NALKTFNVAQFERRWSFDLI 142 >DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosyltransferase 2 protein. Length = 451 Score = 23.8 bits (49), Expect = 4.2 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 207 PSGYDVHLRYFGLGN 251 P G+D L YFG GN Sbjct: 182 PKGHDGALAYFGYGN 196 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 23.4 bits (48), Expect = 5.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = -2 Query: 153 FVVKPILMVIEDRMIKYIM 97 F++KPIL+V E M+K I+ Sbjct: 78 FMLKPILIVTELDMVKRIL 96 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 623,186 Number of Sequences: 2352 Number of extensions: 11956 Number of successful extensions: 27 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56347938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -